KEGG   Phytobacter ursingii: AB182_20075Help
Entry
AB182_20075       CDS       T03950                                 

Definition
(GenBank) multidrug transporter
  KO
K08161  MFS transporter, DHA1 family, multidrug resistance protein
Organism
kin  Phytobacter ursingii
Brite
KEGG Orthology (KO) [BR:kin00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:kin02000]
    AB182_20075
Transporters [BR:kin02000]
 Major facilitator superfamily (MFS)
  Drug transporters
   Drug:H+ antiporter-1 (12 spanner) (DHA1) family [TC:2.A.1.2]
    AB182_20075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 Sugar_tr MFS_1_like MFS_4
Motif
Other DBs
NCBI-ProteinID: AKL15368
UniProt: A0A0G3QKP3
LinkDB All DBs
Position
complement(3482291..3483481)
Genome map
AA seq 396 aa AA seqDB search
MESWRINLISVWFGCFFTGLAISQILPFLPLYVSQLGVSSHEALSMWSGLTFSVTFMVSA
IVSPLWGSLADRKGRKLMLLRASLGMAIAILLQAFATNVWQLLILRGVMGLTSGYIPNAM
ALVASQAPRERSGWALSTLSTAQISGVIGGPLMGGFLADHFGLRTVFLITATLLIVSFLV
TLFLIKEGARPKVSKAQRLSGKAVFSSLPYPGLVISLFLTTLVIQLCNGSIGPILALFIQ
SMTPDSNNIAFLSGMIAAVPGVSALISAPRLGKLGDRIGTARILMATLVCAVVLFFAMSF
VTSPLQLGILRFMLGFADGAMLPAVQTLLLKYSSDQVTGRIFGYNQSFMYLGNVVGPLMG
ASVSAMAGFRWVFVATALVVLCNIWQLALALRKTRR
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggaatcctggagaattaaccttatttccgtatggttcggctgttttttcaccggtctt
gccatcagtcaaatcttaccgttcctgcccttatatgtctcccagttaggggtctcttct
cacgaagctttgtcaatgtggtccgggttgacctttagcgtcacttttatggtttccgcg
atagtgtcaccactctggggcagccttgctgacagaaaagggcgcaaattaatgctgttg
cgcgcctcgctgggtatggcaatcgccattttactgcaggcttttgcgacaaatgtctgg
caattgcttattttacgcggcgtcatgggactcacgtccggttatattcccaatgcaatg
gcgctggtagcctctcaggctcctcgtgagcgtagcggttgggcgctgagtacactctca
acagcgcaaatcagcggagtcattggcgggccgttaatggggggctttctggctgaccat
tttggtttacgaaccgtttttttaatcaccgcgacgctgctgattgtcagttttctggtc
accctgtttttgattaaagagggggcgcgtcctaaggtcagcaaggcacagaggttgagc
ggcaaggccgttttttcctcgctaccttacccaggcctggtcataagtctctttctgacc
acgctggttatccagttatgtaatggttctatcgggcctattctggcgctgtttatccag
tctatgactcctgacagcaacaatattgccttccttagtgggatgattgccgccgtaccg
ggtgtttccgcgcttatctcggcgccgcgtctggggaagcttggcgatcgaattggcacg
gcgcgtattttgatggcaacgttagtctgcgccgtggtgctatttttcgccatgtccttt
gtcacctcgccgctgcaactgggcattctacgttttatgcttggcttcgccgatggcgcg
atgctgcctgccgtacaaacgctgctgcttaaatattccagtgaccaggtgacaggccgt
atttttggttataaccaatcgtttatgtatttaggcaatgtggtcgggccgctaatgggg
gcatccgtttcggcgatggccggattccgctgggtatttgtcgccacggcgcttgtagtc
ttatgcaatatctggcagctcgcgctggcattacgtaaaacgcgacgctga

DBGET integrated database retrieval system