KEGG   Kluyvera intermedia: AB182_20085Help
Entry
AB182_20085       CDS       T03950                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
kin  Kluyvera intermedia
Pathway
kin00473  D-Alanine metabolism
kin00550  Peptidoglycan biosynthesis
kin01100  Metabolic pathways
kin01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:kin00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    AB182_20085
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AB182_20085
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    AB182_20085
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:kin01011]
    AB182_20085
Enzymes [BR:kin01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     AB182_20085
Peptidoglycan biosynthesis and degradation proteins [BR:kin01011]
 Precursor biosynthesis
  Amino acid ligase
   AB182_20085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp ATPgrasp_ST CPSase_L_D2 ATP-grasp_4 RimK
Motif
Other DBs
NCBI-ProteinID: AKL13452
UniProt: A0A0G3QHB3
LinkDB All DBs
Position
3484420..3485520
Genome map
AA seq 366 aa AA seqDB search
MAKLRVGVVFGGKSAEHEVSLQSAKNIVDAMDKSRFDVVLLGIDKQGQWHINDANNYLQN
ASDPARIALNPSESSVALVPGQPSQQLMNASDAKPFAQVDVIFPIVHGTQGEDGTLQGLL
RMANLPFVGSDVLGSAACMDKDVTKRLLRDAGLAIAPFVTLTRSNRDRIPFAEIQAKLGL
PLFVKPANQGSSVGVSKVTSEAQYHAAVSLAFEFDHKVVVETGIIGREIECAVLGNDDPQ
ASTCGEIVLNSEFYAYDTKYIDDNGAQVVVPAAIAPEVNDHIRAIAIQAYQTLGCAGMAR
VDVFLTPDNEVIINEINTLPGFTNISMYPKLWQASGLGYTDLITRLIELALARHQADSAL
KSSMNG
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaactgcgggtaggggtcgtgttcggcggcaagtcggctgaacatgaagtgtcg
ctgcaatcggcaaaaaatattgtcgatgcaatggataaatcgcgtttcgatgtagtactg
ctggggatcgataaacagggtcagtggcatatcaacgacgcgaataattatctacaaaat
gccagcgatccggcgcgaattgcacttaatccctctgaaagcagcgttgcgctggtacca
ggacaaccgtcacagcaactgatgaatgccagtgatgctaagccctttgcgcaagtggat
gtgattttcccgatcgttcatggtacgcagggtgaagacggcacgctacagggcctgctg
cgcatggcaaatctgccttttgttggttccgatgttctgggttccgccgcctgtatggac
aaagacgtgaccaaacgccttctgcgtgatgcaggtctcgccatcgcgccgtttgtcacc
ttaacccgcagcaatcgcgatcgtattccttttgctgagatacaggcgaagcttgggctg
cctctgtttgtgaaacccgccaaccagggctcctccgtcggcgtcagtaaggtcaccagc
gaagcgcaataccatgccgccgtcagcctggcattcgaatttgaccataaagtggttgtc
gaaacaggtatcatcggtcgcgagatcgaatgtgcggtgctgggcaatgacgatccgcag
gccagcacctgtggcgaaatcgtgcttaacagcgagttttacgcctacgacaccaaatac
attgacgataatggtgctcaggtggttgtcccagcggcaatcgcgcccgaagtgaacgat
catatacgtgccatcgctatccaggcttatcagacgctgggctgcgccggaatggcgcgg
gtcgacgtattcctgacgcctgacaacgaagtgatcatcaatgagatcaacacattgccc
ggtttcaccaatatcagcatgtatccgaaactgtggcaggcgagtggtctcggctatacc
gatctgatcacgcgcctgattgaactggccctggcgcgccatcaagctgatagcgcgctg
aaaagctcgatgaacggttaa

DBGET integrated database retrieval system