KEGG   Phytobacter ursingii: AB182_21250Help
Entry
AB182_21250       CDS       T03950                                 

Gene name
ddl
Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
kin  Phytobacter ursingii
Pathway
kin00473  D-Alanine metabolism
kin00550  Peptidoglycan biosynthesis
kin01100  Metabolic pathways
kin01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:kin00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    AB182_21250 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AB182_21250 (ddl)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    AB182_21250 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:kin01011]
    AB182_21250 (ddl)
Enzymes [BR:kin01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     AB182_21250 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:kin01011]
 Precursor biosynthesis
  Amino acid ligase
   AB182_21250 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_4 ATP-grasp_3 ATP-grasp ATPgrasp_YheCD TTL
Motif
Other DBs
NCBI-ProteinID: AKL13661
UniProt: A0A0G3QCU3
LinkDB All DBs
Position
complement(3749403..3750323)
Genome map
AA seq 306 aa AA seqDB search
MADKVAVLLGGISAEREVSLNSGAAVLAGLREGGIDAHPIDPRDVDVTRLKAMGFDKAFI
ALHGRGGEDGSLQGLLELTGVPYTGSGVMASAISMDKLRSKLLWQGAGLPVAPWVALTRN
EFESGLNNDVIQRIEALGLPVIVKPSREGSSVGMSKVEEFGALTAALALAFQHDDEVLIE
KWLSGPEFTVAMLGKEILPSIRIQPAGTFYDYEAKYLSDETKYFCPSGLEANDEATLQNL
VLKAWRALGCRGWGRIDAMLDSDGQFYLLEANTAPGMTSHSLVPMAARQAGLTFSQLVVQ
ILELAE
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggctgataaagtcgcggtcctgctgggcggaatttctgctgagcgcgaggtgtcatta
aactccggcgctgcggtgcttgcgggtttacgtgagggtggcattgatgcgcacccgatt
gacccgcgtgatgtggatgttactcgcctgaaagcgatgggcttcgataaagcattcatt
gcgctgcatgggcgtggcggggaagacggtagtctgcaagggttgctggagctaacaggc
gtgccttataccggcagcggcgttatggcatcggcaatctcaatggataaattacgcagt
aaattgctctggcaaggtgcggggttacctgttgccccgtgggttgctttaacacgcaac
gaatttgaatcggggctcaataatgacgttattcaacgcattgaagcgttaggtttaccg
gttatcgttaaaccgagccgcgaaggttcaagcgtcggtatgtcaaaagttgaagaattt
ggtgcattaacggctgcgttagcgcttgcctttcaacatgatgatgaagttcttatcgaa
aaatggctaagtgggcccgaatttacagttgccatgctcggaaaagaaattttaccttca
attcgtattcagcccgctggaaccttctatgattatgaggcgaagtatctctctgatgag
acgaaatatttctgtccgtcaggtctggaagcaaacgatgaggccactttacaaaacctg
gtactgaaagcctggcgtgcgctgggatgtcggggctggggacgaattgacgccatgtta
gacagtgatggtcagttttatttgttggaagccaataccgcgccgggtatgacaagtcat
agcctggtaccgatggcagcgcgacaggcgggattaaccttctcgcaactggtcgtgcaa
attctggaactggcggagtga

DBGET integrated database retrieval system