KEGG   Phytobacter ursingii: AB182_23320Help
Entry
AB182_23320       CDS       T03950                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
kin  Phytobacter ursingii
Pathway
kin00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:kin00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AB182_23320
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:kin02000]
    AB182_23320
Enzymes [BR:kin01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     AB182_23320
Transporters [BR:kin02000]
 Other Transporters
  Pores ion channels [TC:1]
   AB182_23320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_3 GST_N_4 Tom37 GST_C_2
Motif
Other DBs
NCBI-ProteinID: AKL14041
UniProt: A0A0G3QE09
LinkDB All DBs
Position
complement(4194391..4195059)
Genome map
AA seq 222 aa AA seqDB search
MLKVHHLNQSRSQRILWALEELGLPYQLIHYQREKNMLAPASLKKVHPLGKSPVLEDDDL
IIAESGAILEYLQETYDTNSQLKPQERELRQQYRFWLHYAEGSLMPLLLMKLVFTSLGKP
PVPFGVRTIGKMLGQGIQKAWLNKQIETHARFIESQLAVKPWFAGEQLSMADIQMSFPIF
ALLSRGGITDLPHTQSWKKRVEMRPAWQRAIEQGGPFDLPGA
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgctcaaagttcaccatcttaatcagtctcgttctcagcgcattctgtgggcgctggaa
gaattgggtttaccgtatcaactcattcattatcaacgtgaaaaaaacatgctggcccca
gcgtcactcaaaaaagtgcatccgttgggcaaatcaccggtgcttgaggacgacgatctc
atcattgctgaatccggcgctatcctggaatatttacaggagacctacgatacaaacagc
cagttgaagccacaggagagagagttacgtcagcagtatcgcttttggctgcattatgcc
gaaggatcgttgatgcctttattattaatgaagctggttttcaccagtctcggtaaacca
ccggtgccgtttggtgtgcgaacgataggaaaaatgcttggccagggcatccagaaagcc
tggcttaataagcaaattgaaacccacgcgcgttttatcgagtcgcagctggcggtgaag
ccctggtttgccggagagcagttaagcatggccgacattcagatgagtttcccgattttc
gcattgctgtcgcgaggcggtattaccgatcttccgcatacgcagtcatggaaaaagcgc
gttgaaatgcgcccggcctggcaacgggcgattgagcagggcggcccttttgatctcccc
ggtgcgtaa

DBGET integrated database retrieval system