KEGG   Kluyvera intermedia: AB182_24455Help
Entry
AB182_24455       CDS       T03950                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
kin  Kluyvera intermedia
Pathway
kin00620  Pyruvate metabolism
kin00680  Methane metabolism
kin01100  Metabolic pathways
kin01120  Microbial metabolism in diverse environments
kin01200  Carbon metabolism
Module
kin_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:kin00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AB182_24455
  09102 Energy metabolism
   00680 Methane metabolism
    AB182_24455
Enzymes [BR:kin01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     AB182_24455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AKL14231
UniProt: A0A0G3QEF0
LinkDB All DBs
Position
4431584..4434235
Genome map
AA seq 883 aa AA seqDB search
MNEQYSALRSNVSMLGKLLGDTIKDALGENILDRVETIRKLSKSSRAGNEASRQELLNTL
QNLSNDELLPVARAFSQFLNLANTAEQYHSISPKGEAASNPEVIARTLRKLKDQPDLNEA
TIKQAVESLSLELVLTAHPTEITRRTLIHKMVEVNNCLKQLDNTDIADYERHQLMRRLRQ
LIAQSWHTDEIRKHRPSPVDEAKWGFAVVENSLWEGVPNYLRELNEQLEANLNYKLPVDF
VPVRFTSWMGGDRDGNPNVTAEITRHVLLLSRWKATDLFLKDIQLLISELSMVECTDELR
ELAGAEGAQEPYRYLMKKLRGQLMATQAWLEARLKGQRLPKPEGLLSQNEQLWEPLYACY
KSLQACGMGIIANGELLDTLRRVKCFGVPLVRIDVRQESTRHTEALGELTRYLGIGDYES
WSEADKQAFLIRELNSKRPLLPRNWEPSNETREVLNTCKAIVDAPKGSVAAYVISMAKTP
SDVLGVHLLLKEAGIDYALPVAPLFETLDDLNNANDVMTQLLNIDWYRGFIQGKQMVMIG
YSDSAKDAGVMAASWAQYQAQDALIKTCEKAGIELTLFHGRGGSIGRGGAPAHAALLSQP
PGSLKGGLRVTEQGEMIRFKYGLPEVTISSLSLYTSAILEANLLPPPEPKDAWRHVMDEL
STISCDMYRGYVRENKDFVPYFRSATPEQELGKLPLGSRPAKRRPTGGVESLRAIPWIFA
WTQNRLMLPAWLGAGAALQKVVEDGKQSELEAMCRDWPFFSTRLGMLEMVFSKADLWLAE
YYDQRLVKPELWALGSELRKLLEADINVVLAIANDSHLMADLPWIAESIQLRNIYTDPLN
VLQAELLHRSRKAEEEGKEPDRRVEQALMVTIAGVAAGMRNTG
NT seq 2652 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaacaatattccgctttgcgtagtaatgtcagtatgctcggcaagctgctgggg
gataccatcaaggatgcgttgggagagaatatccttgatagggtcgaaacaatccgtaag
ctgtccaaatcttcacgtgctggtaatgaagcgagtcgtcaggaactgctcaatacgctg
caaaacctgtccaatgatgaactgctgccggtagcccgtgcattcagccagtttctgaac
cttgccaacaccgctgagcaataccacagcatttcgccaaaaggcgaagccgcaagcaac
ccggaagtgattgctcgtactctgcgtaaactgaaagaccaacccgatctcaacgaagcg
accatcaagcaagccgtcgaatcactgtcgctggagctggtactgacagcccacccgaca
gagattacccgccgtacgctgatccataaaatggtggaagtgaataactgcttaaagcag
ttggataataccgatatcgccgattatgagcgccatcaactgatgcgccgactgcgccag
cttatcgcacagtcctggcatactgatgaaatccgtaaacaccgtcccagcccggtcgac
gaagccaagtggggctttgcggtggtggaaaacagcctgtgggaaggtgtgcctaactat
cttcgcgagcttaacgaacagcttgaagcgaacctgaattacaaactgccagtcgatttc
gtaccggtacgctttacctcctggatgggcggcgaccgcgacggcaacccgaacgtcacc
gcagagattacccgtcacgtcctgctgctgagccgctggaaggcgaccgacctgtttctg
aaagatattcagttactgatttctgagctctcgatggttgaatgtaccgacgagcttcgc
gagctggccggtgccgaaggcgctcaggaaccgtaccgttatctgatgaaaaaactgcgc
ggccagctgatggcgacgcaggcctggctggaagcgcgcctgaaaggccaaagactgccg
aaaccagaaggtctgctgagccagaacgaacagctttgggaaccgctttacgcctgttac
aaatctctgcaagcctgcggtatgggcatcatcgcgaatggtgaactgcttgataccctt
aggcgcgtgaaatgctttggcgtaccgctggtgcgtattgatgtgcgtcaggagagcacc
cgtcacaccgaagcgctcggcgaactgacccgttacctgggtatcggcgattatgaaagc
tggtccgaagccgacaaacaggcattcctgattcgcgaactgaactccaaacgtcctctg
ctaccacgtaactgggagccgagcaatgaaacccgcgaggtgctcaatacctgcaaagcg
atcgttgacgcgccgaaaggatcggtagccgcctacgtgatctccatggcgaagacccca
tccgacgtgctgggtgttcatctgttgctaaaagaagccggtatcgactatgccttgccg
gttgcgccgctgtttgaaaccctggacgatctgaacaatgccaacgacgtgatgacccag
ttgctgaacatcgactggtaccgcggctttattcagggcaaacagatggtgatgattggc
tattccgactccgcaaaagacgcgggcgtgatggccgcatcctgggcgcaatatcaggca
caggacgcgctgatcaaaacctgcgagaaagccggcattgagctgacgctgttccacggt
cgtggcggctcgattggtcgtggcggcgccccggcccatgcggcactgctttcacaaccg
ccgggaagtctgaaaggcggcctgcgcgtgaccgaacagggcgagatgatccgcttcaaa
tacggtctgccggaagtgaccatcagcagcctgtcgctgtacaccagcgccattctggaa
gccaacctgctgcctccaccagagccgaaagatgcgtggcgtcacgtcatggatgagctg
tctaccatttcctgtgacatgtatcgtggctatgtgcgcgaaaacaaagactttgtgccg
tacttccgttccgcaacgccggagcaggaactgggcaaattaccgctcggctcacgtccg
gccaagcgtcgtccgaccggcggtgtagagtcattgcgcgccattccgtggattttcgcc
tggacgcaaaaccgcctgatgctgcccgcctggctgggtgcgggtgcggcgctgcaaaaa
gtggtggaagacggcaaacagagcgagctggaagcgatgtgccgcgactggccgttcttc
tcaacccgccttggcatgctggaaatggtgttctccaaagcggacctgtggctcgcggaa
tattacgatcagcgtctggtgaaacctgagctgtgggcgctgggcagtgagttgcgtaag
ctgctcgaagccgacatcaacgtggttctggccatcgccaacgactcccatctgatggcg
gatctgccgtggattgccgagtctatccagctgcgtaatatttatactgacccgctgaac
gtgctgcaggctgagttgctgcaccgttcccgtaaagcggaagaagaaggtaaagaaccg
gatcgccgcgtagagcaggcattgatggtgaccatcgcaggcgttgcggcgggtatgcgt
aatactggctaa

DBGET integrated database retrieval system