KEGG   Phytobacter ursingii: AB182_26130Help
Entry
AB182_26130       CDS       T03950                                 

Gene name
tdh
Definition
(GenBank) L-threonine 3-dehydrogenase
  KO
K00060  threonine 3-dehydrogenase [EC:1.1.1.103]
Organism
kin  Phytobacter ursingii
Pathway
kin00260  Glycine, serine and threonine metabolism
kin01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kin00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AB182_26130 (tdh)
Enzymes [BR:kin01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.103  L-threonine 3-dehydrogenase
     AB182_26130 (tdh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C FAD_binding_3 HI0933_like FAD_oxidored FAD_binding_2 Pyr_redox_3 Methyltransf_25 MTS Pyr_redox UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-ProteinID: AKL14536
UniProt: A0A0G3QFF0
LinkDB All DBs
Position
4783729..4784754
Genome map
AA seq 341 aa AA seqDB search
MKALSKLKAEEGIWMTDVPAPEIGHNDLLIKIRKTAICGTDVHIYNWDEWSQKTIPVPMV
VGHEYVGEVVGIGQEVKGFKIGDRVSGEGHITCGHCRNCRAGRTHLCRNTVGVGVNRPGC
FAEYLVIPAFNAFKIPDNISDDLASIFDPFGNAVHTALSFDLVGEDVLVSGAGPIGIMAA
AVAKHVGARNVVITDVNEYRLDLARKMGVTRAVNVAKENLSDVMAELGMTEGFDVGLEMS
GAPPAFRTMLDTMNHGGRIAMLGIPPSDMAIDWNKVIFKGLFIKGIYGREMFETWYKMAA
LIQSGLDLSPIITHRFGIDDFQKGFDAMRSGQSGKVILSWN
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcgctatctaagctgaaagcggaagaaggcatctggatgaccgatgtgccggct
ccggaaatcggccataacgacctgctgattaaaattcgcaaaaccgctatttgcggtacc
gatgtgcatatctataactgggatgaatggtcgcaaaaaacgatcccggtaccgatggtg
gtcgggcacgagtacgttggcgaagtggtaggcatcggccaggaagtgaagggttttaaa
atcggcgatcgcgtttccggtgaaggccacattacctgcggacattgtcgtaactgccgc
gcgggtcgtacgcacctgtgccgcaataccgtgggtgtcggcgtcaaccgcccgggctgt
tttgctgaatatctggttattcccgcgttcaacgcgttcaaaattccggacaacatttcc
gacgatctggcctctattttcgatccgttcggcaatgcggtgcacaccgcgctctccttc
gacctggtcggggaagacgtgctggtctctggcgctggcccgattggcattatggcggcg
gcggtggcaaaacacgttggcgcgcgcaatgtggttatcactgacgtgaatgaataccgt
ctggatctggcgcgtaaaatgggcgttacccgcgcagtgaacgtggcgaaagagaacctg
tccgatgtgatggccgagctgggaatgacagaaggttttgatgtcgggctggaaatgtcc
ggcgcgccgccagccttccgtaccatgctcgataccatgaaccacggcggtcgtattgcg
atgctcggtattccgccgtctgatatggcaatcgactggaataaagttatcttcaagggt
ctctttattaaaggtatctatggccgtgaaatgtttgagacctggtacaaaatggcggca
ttaattcagtccggactggatttgtcccctattatcactcaccgtttcggcattgatgac
ttccagaaaggatttgatgcgatgcgttctggacagtctggtaaggtaatccttagctgg
aactaa

DBGET integrated database retrieval system