KEGG   Phytobacter ursingii: AB182_27125Help
Entry
AB182_27125       CDS       T03950                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
kin  Phytobacter ursingii
Pathway
kin00250  Alanine, aspartate and glutamate metabolism
kin00410  beta-Alanine metabolism
kin00640  Propanoate metabolism
kin00650  Butanoate metabolism
kin01100  Metabolic pathways
kin01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:kin00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    AB182_27125
   00650 Butanoate metabolism
    AB182_27125
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AB182_27125
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AB182_27125
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:kin01007]
    AB182_27125
Enzymes [BR:kin01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     AB182_27125
Amino acid related enzymes [BR:kin01007]
 Aminotransferase (transaminase)
  Class III
   AB182_27125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AKL15441
UniProt: A0A0G3QHU7
LinkDB All DBs
Position
5006955..5008220
Genome map
AA seq 421 aa AA seqDB search
MKNNELHQRRLQATPRGIGVMCGFYAEKAENATLWDVEGNEVIDFAAGIAVLNTGHRHPK
IVAAVEKQLQAFTHTAYQIVPYESYVSLAERINERVPVDGPAKTAFFSTGAEALENAVKI
ARAYTKRPGVITFGGGFHGRTYMTMALTGKVAPYKIGFGPFPGSIFHAQFPNTLHGVSTD
DALKSLDRIFKADIAPDQVAAILLEPVQGEGGFNIAPDDFMQALRKLCDTHGILLITDEV
QSGFARTGKLFAVEHYSVKPDLITMAKSLAGGLPLSAVAGRAEVMDAPAPGGLGGTYAGN
PLAVAAAHAVMDVIDEENLCERANHLGKHLVEVLTKAKADCPYIADIRAQGSMVAVEFND
PQSGEPSAEFTKQVQDKALAAGLLLLSCGVYGNVIRFLYPLTIPEVQFRKALDILYQSLT
H
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
gtgaagaataacgaattacatcaacgccgtttacaggcgacaccgcgtggtattggcgtg
atgtgcggcttctatgccgaaaaagcagaaaacgcgacgctctgggatgtggaaggcaac
gaagtcatcgatttcgccgccgggattgcagtgctcaataccgggcatcgtcacccaaaa
atcgtcgcagcggtggaaaaacagctgcaggcgtttacccatacggcctatcaaattgtc
ccgtacgaaagctatgtctcgctggcggaacgcattaacgaacgcgtgccggtagacggc
ccggccaaaacggcctttttctcgactggggcggaagcactggaaaacgcggtgaaaatt
gcccgcgcctataccaaacgaccaggtgtgattaccttcggcggcggcttccacggacgt
acctatatgaccatggcgctgaccggtaaagtggcgccgtacaaaatcggctttggcccg
tttcctggttccattttccatgcgcaatttcccaatacgctccatggtgtaagcactgac
gatgcactgaaaagtctggatcgtatcttcaaagcggatatcgcccccgatcaggttgcg
gctatcctgcttgaaccggttcaaggggaaggcggattcaatattgcccctgacgacttt
atgcaggcgctgcgtaaactctgcgacactcacggcattctgctgattaccgatgaagtg
caatctggctttgcgcgcaccggtaaactctttgcggtggaacattacagcgtcaaaccg
gacttgatcaccatggcgaagagtctggcaggtggcctgccgctttctgcggtagcgggg
cgtgcggaagtcatggacgcaccggcaccgggcggtttgggcggtacttatgccggcaac
ccattagccgtggccgcggcgcatgccgtgatggatgtgattgacgaagagaatctgtgc
gaacgcgcgaaccacctgggtaaacatctggtagaagtgctgactaaagcgaaagcagac
tgcccgtacattgcggatattcgcgctcagggttctatggtcgccgtggaatttaacgat
ccgcaaagcggggagccgtcggcggaatttacgaaacaagtacaggataaagcgctggcc
gccgggttgttgctgttgagttgtggtgtctacggcaacgtgatccgcttcctctatccg
ctgaccatcccggaagttcagttccgtaaagcactggatattctctaccagtcgctgacc
cactaa

DBGET integrated database retrieval system