KEGG   Phytobacter ursingii: AB182_28190Help
Entry
AB182_28190       CDS       T03950                                 

Gene name
sspA
Definition
(GenBank) stringent starvation protein A
  KO
K03599  stringent starvation protein A
Organism
kin  Phytobacter ursingii
Brite
KEGG Orthology (KO) [BR:kin00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:kin03021]
    AB182_28190 (sspA)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:kin02000]
    AB182_28190 (sspA)
Transcription machinery [BR:kin03021]
 Prokaryotic type
  Bacterial type
   Other transcription-related factors
    RNA polymerase-associated proteins
     AB182_28190 (sspA)
Transporters [BR:kin02000]
 Other Transporters
  Pores ion channels [TC:1]
   AB182_28190 (sspA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_2 Glutaredoxin GST_C_5
Motif
Other DBs
NCBI-ProteinID: AKL14918
UniProt: A0A0G3QJK1
LinkDB All DBs
Position
5212548..5213186
Genome map
AA seq 212 aa AA seqDB search
MAVAANKRSVMTLFSGPVDIYSHQVRIVLAEKGVSFEIEHVEKDNPPQDLIDLNPNQSVP
TLVDRELTLWESRIIMEYLDERFPHPPLMPVYPVARGESRLYMHRIEKDWYSLMEVIMSS
SGAQADNARRQLREELMQIAPVFGQKPYFLSDEFSLVDCYLAPLLWRLPILGIELSGAGS
KELKGYMTRVFERDSFLASLTEAEREMRLGRG
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atggctgtcgctgccaacaaacgttcggtaatgacgctgttttctggtcctgttgacatc
tatagccatcaggtccgtatcgtgctggcagaaaaaggtgtcagcttcgaaattgagcac
gtggaaaaggataatcctcctcaggatctgattgacctcaacccgaatcaaagcgtaccg
acccttgtcgatcgtgaactcactctgtgggaatcacgcattatcatggaatacctggat
gagcgttttcctcatccgccgctgatgccggtttatccggttgcgcgtggtgaaagccgt
ctttacatgcatcgcattgagaaagactggtattcgctgatggaagtgatcatgtccagc
agcggcgcgcaggccgataacgcccgccgtcaactgcgtgaagaactgatgcagattgct
ccggtgttcggccagaagccgtacttcctgagtgatgaattcagcctggtggattgctac
ctggcgccgttgctgtggcgtttgccgattctgggtattgaactcagcggtgcaggctcg
aaagagctgaaaggctacatgacacgtgttttcgaacgcgattcattcctcgcgtctctg
acagaagccgagcgcgaaatgcgcctgggccggggctaa

DBGET integrated database retrieval system