KEGG   Kitasatospora sp. MMS16-BH015: CFP65_0299Help
Entry
CFP65_0299        CDS       T05366                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
kit  Kitasatospora sp. MMS16-BH015
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-ProteinID: AUG75274
UniProt: A0A2H5ASY0
LinkDB All DBs
Position
complement(335853..336902)
Genome map
AA seq 349 aa AA seqDB search
MPPVDPMLAKAVPEIPPGLHYEAKWDGFRAVVFRDGEEVEVGSRTGKPLTRYFPELVAAF
RRELPQRCVLDGEIVIAHDGRLHFEELLERIHPAASRVRTLAERTPASYVAFDLLALGAE
KYADRPLAERRAALVEALAGARPPVFTAPATTDLELAKVWFAQFEGAGLDGVVAKPPDQP
YRPGARTMYKIKHARTADCVLAGYREHKSGPVVGSLLLGLYDGAGQLQHVGVSASFPMAK
RRELAEQLQVLRLDDLSGHPWAAWAEESAHESARLPGAQSRWTGGKDLSWVPLRPELVCE
VAYDHMEGTRFRHTTQFRRWRPDRTPESCTYEQLEEPVGYDLAELLPGS
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgccgccggtcgacccgatgctggcgaaggccgtgcccgagatcccgccgggcctgcac
tacgaggcgaagtgggacggcttccgggccgtggtgttccgggacggcgaggaggtggag
gtcgggagccggacggggaagccgctgaccaggtacttccccgagctggtggcggccttc
cggcgggagctgcctcagcggtgcgtgctggacggggagatcgtgatcgcccacgacggg
cggctgcacttcgaggagctactggagcggatccacccggcggcctcccgggtgcggacg
ctggccgagcgcaccccggcgagctacgtggccttcgacctgctggcgctgggggcggag
aagtacgccgaccgaccgctggccgagcggcgggccgcgctggtcgaggcgctggccggg
gccaggccgccggtgttcaccgcgcccgcgaccacggacctggagctggcgaaggtctgg
ttcgcgcagttcgagggggcgggtctggacggggtggtggccaagccgccggaccagccg
taccggcccggggcgcggaccatgtacaagatcaagcacgcccggacggccgactgcgtg
ctcgccgggtaccgggagcacaagagcgggccggtggtcggctcgctgctgctcgggctg
tacgacggggccgggcagctccagcacgtcggggtcagcgcctccttcccgatggccaag
cggcgcgaactggccgagcagctccaggtgttgcggctcgacgacctctctgggcacccg
tgggccgcctgggccgaggagagcgcgcacgagagcgcccggctgcccggggcgcagagc
aggtggacgggcgggaaggacctgtcctgggtgccgctgcggcctgagctggtctgcgag
gtggcgtacgaccacatggagggcacccggttccggcacaccacgcagttccgccgctgg
cggccggaccggacgccggagagttgcacgtacgagcagcttgaggagccggtgggctac
gacctggccgagctgctgcccgggagctga

DBGET integrated database retrieval system