KEGG   Kitasatospora sp. MMS16-BH015: CFP65_1462Help
Entry
CFP65_1462        CDS       T05366                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
kit  Kitasatospora sp. MMS16-BH015
Pathway
kit03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:kit00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    CFP65_1462
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:kit03400]
    CFP65_1462
Enzymes [BR:kit01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     CFP65_1462
DNA repair and recombination proteins [BR:kit03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     CFP65_1462
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AUG76359
UniProt: A0A2H5AW28
LinkDB All DBs
Position
complement(1730011..1730877)
Genome map
AA seq 288 aa AA seqDB search
MTITEVDGRQLRLTHLDRVLYPETGWTKAAALRYYALVAPKLLPHLAGRPASFLRFPGGV
AEQRFWAKHLPAGAPDWLTTMQVTHSEGELEQVVVADLPTLIWAANLGALELHVPQWRED
PAEHDRLVVDLDPGPGMSVVECCAVALLARELLVADGLTVWPKTSGAKGLHLAVPLRPTP
ARTAGAYARELAARLRVAHPGLVVDRMERRLRTGRVFVDWSQNNSAKTTAAPYSLRAGRV
PGVSTPLEWAEVAACRSAEQLAFTPEQVAERAGDPWAGVLEEANWGRL
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
gtgaccatcacggaggtggacggcaggcagctccggctgacccatctggaccgagtgctc
taccccgagaccgggtggaccaaggccgccgcgctgcgctactacgccctggtggcaccg
aagttgctgccgcacctggctgggcggccggcctccttcctgcgcttcccgggtggggtg
gcggagcagcggttctgggccaagcacctgccggcgggggctccggactggctgactacg
atgcaagtgacgcacagcgagggcgagttggagcaggtggtggtggccgatctgcccacc
ctgatctgggcggccaatctcggcgcgctggagctgcacgtgccgcagtggcgggaggac
ccggccgagcacgaccggctggtggtcgacctggatccggggcccgggatgtcggtggtg
gagtgctgcgcggtggccctgctggccagggagttgctggtggcggacgggctgaccgtc
tggccgaagacctccggggcgaagggtctgcacctggcggtgccgctgcggccgactccg
gcgcggacggccggggcgtacgcgcgggagctggccgcccggctgcgggtggcgcacccc
gggttggtggtggaccggatggagcggcggctgcggacgggccgggtcttcgtggactgg
tcgcagaacaacagcgccaagaccacggccgcgccgtactcgttgcgggccgggcgggtg
ccgggcgtgtccaccccgctggagtgggccgaggtggcggcctgccggagtgcggagcag
ctggccttcaccccggagcaggtggccgagcgggccggtgacccgtgggccggggtgctg
gaggaggccaactggggtcggctgtaa

DBGET integrated database retrieval system