KEGG   Kitasatospora sp. MMS16-BH015: CFP65_1749Help
Entry
CFP65_1749        CDS       T05366                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
kit  Kitasatospora sp. MMS16-BH015
Pathway
kit00010  Glycolysis / Gluconeogenesis
kit00053  Ascorbate and aldarate metabolism
kit00071  Fatty acid degradation
kit00280  Valine, leucine and isoleucine degradation
kit00310  Lysine degradation
kit00330  Arginine and proline metabolism
kit00340  Histidine metabolism
kit00380  Tryptophan metabolism
kit00410  beta-Alanine metabolism
kit00561  Glycerolipid metabolism
kit00620  Pyruvate metabolism
kit00625  Chloroalkane and chloroalkene degradation
kit00903  Limonene and pinene degradation
kit01100  Metabolic pathways
kit01110  Biosynthesis of secondary metabolites
kit01120  Microbial metabolism in diverse environments
kit01130  Biosynthesis of antibiotics
Module
kit_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:kit00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CFP65_1749
   00053 Ascorbate and aldarate metabolism
    CFP65_1749
   00620 Pyruvate metabolism
    CFP65_1749
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CFP65_1749
   00561 Glycerolipid metabolism
    CFP65_1749
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CFP65_1749
   00310 Lysine degradation
    CFP65_1749
   00330 Arginine and proline metabolism
    CFP65_1749
   00340 Histidine metabolism
    CFP65_1749
   00380 Tryptophan metabolism
    CFP65_1749
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CFP65_1749
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CFP65_1749
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    CFP65_1749
Enzymes [BR:kit01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     CFP65_1749
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AUG76627
UniProt: A0A2H5AWU2
LinkDB All DBs
Position
complement(2062005..2063462)
Genome map
AA seq 485 aa AA seqDB search
MSYFSQLSRQYIDGEWTTGTGSWDIVDLNPYDGEKLASITVATVDELDRAYRAAARVQKE
WAKQNPYARRLVFERVLRLIEEREREITETIIAELGGTYLKAAFEISLCKDMLREAMQLS
LRAEGRILPSPVDGKENRLYRLPVGVVGVISPFNFPFFLSLKAVAPALSLGNGVVLKPHQ
DAPVTGGTLIAKLFEDAGLPPGLLNVVLTDIAEIGDAFIEHPVPKVIAFTGSDSVGRHVA
QVAAGHFKRTVLELGGNSALVVLDDADVDYAVDAAVFSRFAHQGQVCMAANRVLVDRSIL
AEFTEKFVAKVATLRVGDPSDPSTQIGPLINTAQADAVTAQVDKAVEEGAQVLLRGQTVG
ALMDPVVLGGVPDGAAILRREVFGPVVLLVPFDGEEDAVRIANDTPFGLSGAVHTGDIER
GVRFAQRIETGMIHINDGTIADEPIVPFGGEKSSGLGRLNGEATVDAFTTLKWISIQHER
SRFPF
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgtcctacttctcgcaactgtcgcggcagtacatcgacggtgagtggaccaccggcacc
ggatcctgggacatcgtcgacctgaacccgtacgacggcgagaagctggcctcgatcacc
gtggccaccgtggacgagctggaccgggcgtaccgggcggccgcgcgggtgcagaaggag
tgggccaagcagaacccgtacgcgcggcggctggtcttcgagcgggtgctccggctgatc
gaggagcgcgagcgggagatcaccgagacgatcatcgccgagctcggcgggacgtacctc
aaggccgcgttcgagatctcgctctgcaaggacatgctgcgcgaggccatgcagctctcg
ctccgcgccgagggccggatcctgccctcgccggtggacggcaaggagaaccgcctctac
cgcctgccggtcggcgtggtcggcgtgatcagcccgttcaacttcccgttcttcctctcg
ctcaaggccgtcgcccccgcgctctcgctcggcaacggcgtggtgctcaagccgcaccag
gacgcacccgtgaccggcggcaccctgatcgccaagctcttcgaggacgccggcctgccg
ccgggcctgctcaacgtggtgctcaccgacatcgccgagatcggcgacgccttcatcgag
cacccggtgcccaaggtgatcgccttcaccggctccgactcggtcggccgacacgtggcc
caggtggccgccggccacttcaagcggacggtgctggagctgggcggcaacagcgcgctg
gtcgtgctggacgacgccgacgtggactacgcggtggacgcggccgtgttcagccgcttc
gcgcaccaggggcaggtctgcatggcggccaaccgggtgctggtcgaccggtcgatcctg
gccgagttcaccgagaagttcgtcgccaaggtcgccaccctgcgcgtcggcgacccgagc
gacccgagcacccagatcggcccgctgatcaacaccgcccaggccgacgccgtcaccgcg
caggtggacaaggccgtcgaggagggcgcccaggtgctgctgcgcgggcagacggtcggc
gcgctgatggacccggtggtgctgggcggcgtccccgacggcgccgcgatcctgcgccgc
gaggtcttcggcccggtcgtcctgctggtgcccttcgacggcgaggaggacgccgtccgg
atcgccaacgacaccccgttcggcctgagcggcgccgtgcacaccggcgacatcgagcgc
ggcgtccgcttcgcccagcggatcgagaccggcatgatccacatcaacgacggcaccatc
gccgacgagccgatcgtgcccttcggcggcgagaagtcctcgggcctcggccgcctgaac
ggcgaggccaccgtggacgccttcaccacgctcaagtggatctccatccagcacgagcgt
tcgcgcttcccgttctag

DBGET integrated database retrieval system