KEGG   Kitasatospora sp. MMS16-BH015: CFP65_2126Help
Entry
CFP65_2126        CDS       T05366                                 

Definition
(GenBank) aldehyde dehydrogenase
Organism
kit  Kitasatospora sp. MMS16-BH015
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC
Motif
Other DBs
NCBI-ProteinID: AUG76981
UniProt: A0A2H5AXW6
LinkDB All DBs
Position
complement(2491332..2492837)
Genome map
AA seq 501 aa AA seqDB search
MGGGQGSGEGQQPGGGVGQPGGGVLEYDELFIGGVYTAPAGSETIEVVSPHTERVIGRVP
HASREDVDRAVTAARRAFDEGPWPRLSLAERAALVGRIRDGIKARAEEFARLIGAQNGSP
YSWGIRAQALGAAAIWTAYLRTAEGHPFEERRQGQFGLLVVRREPVGVVAAVAPWNVPQF
VAAAKLAPALLAGCTVVLKPSPETPLDSYLLAEVVREAGLPEGVLSILPADRDVSAHLVA
HPGVDKVSFTGSVAAGQQIMASAARTLKRVTLELGGKSAAIVLPDADLDTAVKGLLASAF
MNNGQACVAQTRVLLPRERYEEIADRLTSEVAAFKVGDPLDPATEIGPLVTRRQQQRSLD
YIALGEREGAKLLTGGGRPAGQATGWYVEPTLFGEVDNGMRIAQEEIFGPVVCLIPYEGE
AEAVRLANDSVYGLSGSVWTADPDRGLDLARRVRTGTFSVNTFSIDYLGPFGGYKQSGLG
REFGPEGLDEYLESKTISLPR
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgggtggcggccaggggtcgggcgaggggcagcagccgggcggcggggtggggcagccg
ggtggcggggtgctggagtacgacgagctgttcatcggtggggtgtacaccgcccccgcc
gggtcggagaccatcgaggtggtctcgccgcacaccgagcgggtgatcggccgggtgccg
cacgcctcccgcgaggacgtggaccgcgcggtgacggccgcccggcgggccttcgacgag
ggcccctggccccggctgagcctggccgagcgggcggcgttggtggggcggatccgggac
gggatcaaggcccgcgccgaggagttcgcccggctgatcggcgcgcagaacggttcgccg
tactcctggggcatccgggcccaggcgctgggcgccgccgcgatctggaccgcgtatctg
aggacggccgaggggcaccccttcgaggagcggcgccagggccagttcggcctgctggtg
gtgcggcgcgaaccggtcggggtggtggcggccgtggcgccgtggaacgtgccgcagttc
gtggccgcggcgaagctcgccccggcgctgctggccggctgcacggtggtgctcaagccc
tccccggagaccccgctggactcctacctgctggccgaggtggtccgcgaggccggcctg
cccgagggcgtgctcagcatcctgcccgccgaccgcgatgtgagcgctcacctggtcgcc
caccccggcgtggacaaggtctccttcaccggttcggtcgccgccgggcagcagatcatg
gcctccgccgcccgcaccctcaagcgcgtcaccctggagctcggcggcaagtccgcggcg
atcgtcctgccggacgccgacctggacaccgcggtgaagggcctgctggcctcggcgttc
atgaacaacggtcaggcctgcgtcgcgcagacccgcgtgctgctgccgcgcgaacgctac
gaggagatcgccgaccgcctcaccagcgaggtcgcggcgttcaaggtcggcgacccgctg
gacccggcgacggagatcggcccgctggtgacgcggcgccagcagcagcgcagcctcgac
tacatcgccctcggtgagcgggagggcgccaagctgctcaccggcggcggacgcccggcc
gggcaggccaccggctggtacgtggagccgacgctgttcggggaggtggacaacggcatg
cggatcgcccaggaggagatcttcggcccggtggtctgcctgatcccctacgagggggag
gcggaagccgtccggctggccaacgactcggtgtacggcctctccggcagcgtctggacg
gccgacccggaccgcggcctcgacctggcccgccgggtccgcaccggcaccttctccgtc
aacaccttctcgatcgactacctcggcccgttcggcggctacaagcagtcgggactgggg
cgggagttcggcccggagggcctggacgagtacctcgagtcgaagaccatttcgctccca
cggtaa

DBGET integrated database retrieval system