KEGG   Kitasatospora sp. MMS16-BH015: CFP65_2169Help
Entry
CFP65_2169        CDS       T05366                                 

Definition
(GenBank) kynureninase
  KO
K01556  kynureninase [EC:3.7.1.3]
Organism
kit  Kitasatospora sp. MMS16-BH015
Pathway
kit00380  Tryptophan metabolism
kit01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kit00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    CFP65_2169
Enzymes [BR:kit01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     CFP65_2169
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AUG77020
UniProt: A0A2H5AY55
LinkDB All DBs
Position
2534466..2535704
Genome map
AA seq 412 aa AA seqDB search
MSVHPLTREECLALDAADPLAHFRAEFTLPEGLIYLDGNSLGALPVRTSARVRELVEVEW
GQELIKSWNDAGWFRLPHTLGARVAPLLGAAPGQLVVCDTTSVNLFKVLSAALRLRPGRG
TVLAERAAFPTDLYIVEGVTSLAKGSRLELLDHADRLDDLLDEGVAAVVLSHVDYRTGEL
LDMPGITRRVQAAGALMIWDVCHSVAALPIELDASGVDFAVGCTYKYLNGGPGSPAFLYV
AERHLATAAQPLSGWFGHARPFAFEPGYEPLDGIGRFLTSSPSMLGQAALGASLDVWEKA
DLATVRAKSLALTDLFVSLVEQLDGIEVVTPREHERRGSQIALRHSDGYPVVQALIARGV
VGDFRAPDLMRFGFTPLYLSYTEVWDAARHLAEVLESGEWRDERFNRRGEVT
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgttcacccgctgacccgcgaggagtgcctggcgctcgacgccgccgatccgctg
gcccacttccgggccgagttcaccctccccgagggcctgatctacctggacggcaactcg
ctgggcgcgctgcccgtccgcacctcggcgcgggtccgcgagctggtcgaggtggagtgg
ggccaggagctgatcaagagctggaacgacgccggctggttccggctgccgcacaccctc
ggcgcccgggtcgccccgctgctgggcgcggcaccggggcagctggtggtctgcgacacc
acctcggtcaacctcttcaaggtgctgtccgccgcgctgcggctgcggcccggccgcggc
acggtgctggccgagcgggccgccttccccaccgacctgtacatcgtcgagggcgtgacc
tcgctggccaagggttcgcggctcgaactgctcgaccacgccgaccggttggacgatctg
ctggacgagggcgtggcggccgtggtgctcagccacgtggactaccgcaccggcgagctg
ctcgacatgccgggcatcacccggcgggtgcaggcggccggcgccctgatgatctgggac
gtctgccactcggtcgctgcgctgccgatcgaactcgacgcctcgggcgtggacttcgcg
gtcggctgcacctacaagtacctcaacggcggcccgggctcccccgccttcctgtacgtg
gccgagcgccacctggccaccgccgcccagccgttgagcggctggttcggtcacgcccgg
ccgttcgccttcgagcccggctacgaaccgctggacggcatcggccggttcctcaccagc
tcgccctcgatgctgggccaggccgccctcggcgccagcctggacgtgtgggagaaggcc
gacctggcgacggtgcgggccaagagcctggcactgaccgacctgttcgtctccctggtg
gagcagctggacggcatcgaggtggtcaccccgcgcgagcacgagcggcgcggcagccag
atcgccctgcggcacagcgacggctaccccgtcgtccaggccctgatcgcgcgcggcgtg
gtcggcgacttccgcgcgccggacctgatgcgcttcggcttcacccccctctacctctcc
tacaccgaggtctgggacgccgcccgccacctcgccgaggtgctggagagcggcgagtgg
cgggacgagcggttcaaccggcgcggcgaagtcacctga

DBGET integrated database retrieval system