KEGG   Kitasatospora sp. MMS16-BH015: CFP65_2262Help
Entry
CFP65_2262        CDS       T05366                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
kit  Kitasatospora sp. MMS16-BH015
Pathway
kit00250  Alanine, aspartate and glutamate metabolism
kit00410  beta-Alanine metabolism
kit00430  Taurine and hypotaurine metabolism
kit00650  Butanoate metabolism
kit01100  Metabolic pathways
kit01110  Biosynthesis of secondary metabolites
kit01120  Microbial metabolism in diverse environments
kit02024  Quorum sensing
Module
kit_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:kit00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    CFP65_2262
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CFP65_2262
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CFP65_2262
   00430 Taurine and hypotaurine metabolism
    CFP65_2262
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    CFP65_2262
Enzymes [BR:kit01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     CFP65_2262
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: AUG77102
UniProt: A0A2H5AY84
LinkDB All DBs
Position
complement(2635754..2637157)
Genome map
AA seq 467 aa AA seqDB search
MPLHHGDARDHRLDVPPLLGAADPLGSMRLSPPLHQLPDGPIPPGTAYQLIHDELMLDGN
AKLNLATFVTTSMEVQAEKLMAECLDKNMIDKDEYPQTAELERRCVAILGHLWHAPDQAQ
VIGCSTTGSSEACMLAGMALKRRWMRRNADRYVAGARPNLVMGINVQVCWEKFCNFWEVE
PRLAPMEGERYHLDAERASALCDENTIGVVGVLGSTFDGSYEPVAEICAALDGLEERTGL
DIPVHVDGASGGMVAPFLDPGLVWDFQLPRVASINTSGHKYGLVYPGVGWALWRDKEALP
EELVFKVNYLGGEMPTFALNFSRPGAEVVAQYYTFLRLGRAGYRAVQQACRDVAGYLATS
IEEFGCFRLLTRGDQLPVFAFTVAEGQPFDVFDVSRRLRERGWQVPAYTFPADRTDLSVL
RIVCRNGFSRDLADLLLADLARLLPELGRQPAPLQELGVQPRPGFHH
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgccactgcaccacggcgacgcgcgcgaccaccgactcgacgtccccccgctgctcggc
gcggccgacccgctcgggtcgatgcggctctcgccgccgctgcaccagctgcccgacggg
ccgatcccgcccggcaccgcctaccagttgatccacgacgagctgatgctggacggcaac
gccaagctcaacctggccaccttcgtgaccacctcgatggaggtgcaggcggagaagctg
atggccgagtgcctcgacaagaacatgatcgacaaggacgagtacccgcagaccgccgag
ctggagcgccgctgcgtggcgatcctcggccacctctggcacgcccccgaccaggcccag
gtgatcggctgctcgaccaccggctccagcgaggcctgcatgctggccggcatggcgctc
aagcgccgctggatgcggcgcaacgcggaccggtacgtggccggggcccggcccaatctg
gtgatgggcatcaacgtccaggtctgctgggagaagttctgcaacttctgggaggtcgag
ccgaggctcgcaccgatggagggtgagcgctaccacctggacgcggaacgggcgtcggcc
ctctgcgacgagaacaccatcggggtggtcggggtgctcggctccaccttcgacggcagt
tacgagccggtggccgagatctgcgccgcgctggacggcctcgaggagcgcaccggcctg
gacatcccggtgcacgtggacggggcctccggcgggatggtcgcgcccttcctcgacccg
ggcctggtctgggacttccaactgccccgggtggcctcgatcaacacctcgggccacaag
tacggcctggtctaccccggggtcggctgggcgctctggcgggacaaggaggcgctgccc
gaggagctggtcttcaaggtcaactacctgggcggcgagatgcccaccttcgcgctcaac
ttctcccgccccggggccgaagtggtcgcccagtactacacgttcctccggctcggccgg
gccggctaccgcgcggtgcagcaggcctgccgggacgtggcgggctacctggccacctcg
atcgaggagttcggctgcttccggctgctcacccggggcgaccaactgccggtcttcgcc
ttcacggtggccgaggggcagcccttcgacgtgttcgacgtctcccggcggctgcgcgag
cgcggctggcaggtgcccgcctacaccttccccgccgaccgcaccgacctctcggtgctg
cggatcgtctgccgcaacggcttctcccgcgacctggccgacctgctgctcgccgacctg
gcccggctgctgcccgaactcggccgccagcccgcgccgttgcaggagctgggggtgcag
ccgcgcccaggcttccaccactga

DBGET integrated database retrieval system