KEGG   Kitasatospora sp. MMS16-BH015: CFP65_3950Help
Entry
CFP65_3950        CDS       T05366                                 

Definition
(GenBank) alpha-L-glutamate ligase
  KO
K05827  [lysine-biosynthesis-protein LysW]---L-2-aminoadipate ligase [EC:6.3.2.43]
Organism
kit  Kitasatospora sp. MMS16-BH015
Pathway
kit00300  Lysine biosynthesis
kit01100  Metabolic pathways
kit01210  2-Oxocarboxylic acid metabolism
kit01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:kit00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    CFP65_3950
Enzymes [BR:kit01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.43  [lysine-biosynthesis-protein LysW]---L-2-aminoadipate ligase
     CFP65_3950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RimK ATP-grasp_3 GSH-S_ATP ATPgrasp_ST CPSase_L_D2 ATP-grasp CP_ATPgrasp_2
Motif
Other DBs
NCBI-ProteinID: AUG78722
UniProt: A0A2H5B2T8
LinkDB All DBs
Position
4617303..4618142
Genome map
AA seq 279 aa AA seqDB search
MLASRVGADEKRLFDAFDRRGVPFEHLDPRRLWFPAGQRELPWGLALNREIGQTRAAYAA
RCLAAAGVEVLNSVTATEVCGDKWLTTQALEAARVPTPRTALGLTPEAALAALDESIGYP
ALIKPLVGSWGRLVVQLPDRAAAEAVLEYAGALTGPQSHLGYVQELIDKPDRDIRVIVVG
GQVVGAIYRTGEGLRTNVALGGRALPCEVTPEIEKLSLEAAAAVGADIAGVDLIEAGDGR
LLVLEVNHRVEFSGFQAALGDRVSVADHILDHLLERAAR
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
gtgctcgccagccgggtcggcgcggacgagaagcggctgttcgacgccttcgaccggcgc
ggcgtccccttcgagcacctcgacccgcgccggctctggttcccggccgggcagcgcgag
ctgccctggggcctcgcgctgaaccgggagatcggccagacccgggcggcctacgcggcc
cgctgcctggccgccgccggggtcgaggtgctcaacagcgtgaccgcgaccgaggtctgc
ggcgacaagtggctcaccacccaggccctggaggccgcccgggtgccgaccccgcgcacc
gcgctgggcctcaccccggaggccgcgctggccgcgctggacgaatccatcggctacccg
gcgctgatcaagccgctggtcggctcctggggccggctggtcgtccaactccccgaccgg
gcggcggccgaggccgtgctggagtacgccggcgcgctcaccggcccgcagtcgcacctg
ggttacgtgcaggagctgatcgacaaacccgaccgggacatccgggtgatcgtggtcggc
gggcaggtggtcggcgcgatctaccgcactggcgagggcctgcgcaccaacgtggccctc
ggcggcagggcgctgccctgcgaggtgaccccggagatcgagaagctctccctcgaggcc
gccgccgccgtcggcgcggacatcgccggggtcgacctgatcgaggccggcgacggccgg
ctgctggtgctggaggtcaaccaccgggtggagttctccggcttccaggccgccctcggc
gaccgggtcagcgtcgccgaccacatcctcgaccacctcctggaacgggcagcgcgatga

DBGET integrated database retrieval system