KEGG   Kitasatospora sp. MMS16-BH015: CFP65_4914Help
Entry
CFP65_4914        CDS       T05366                                 

Definition
(GenBank) superoxide dismutase
  KO
K00518  nickel superoxide dismutase [EC:1.15.1.1]
Organism
kit  Kitasatospora sp. MMS16-BH015
Brite
KEGG Orthology (KO) [BR:kit00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CFP65_4914
Enzymes [BR:kit01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     CFP65_4914
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Ni Phage_clamp_A
Motif
Other DBs
NCBI-ProteinID: AUG79632
UniProt: A0A2H5B5E8
LinkDB All DBs
Position
complement(5722988..5723383)
Genome map
AA seq 131 aa AA seqDB search
MFSRLFAPRATAHAHCDLPCGVYDPAQARIEAESVKATQEKYQANEDASFRTRAIVIKEE
RAELVKHHLSVLHTDYFKAPHFEKYPQLHELFNQAGKAASAAKGSNDPATGQALLDLIAQ
IDAIFWETKKA
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgttctctcgtctgtttgctccgcgagccaccgcgcacgcccactgcgacctgccctgc
ggcgtctacgacccggcccaggcccggatcgaggccgagtcggtgaaggccactcaggag
aagtaccaggccaacgaggacgcgtcgttccgcacgcgcgccatcgtcatcaaggaggag
cgcgccgagctggtcaagcaccacctctcggtgctgcacaccgactacttcaaggccccg
cacttcgagaagtacccgcagctgcacgagctgttcaaccaggccggcaaggccgcctcg
gccgccaagggctcgaacgacccggccaccggccaggccctgctcgacctgatcgcccag
atcgacgcgatcttctgggagaccaagaaggcctga

DBGET integrated database retrieval system