KEGG   Kitasatospora sp. MMS16-BH015: CFP65_5118Help
Entry
CFP65_5118        CDS       T05366                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
kit  Kitasatospora sp. MMS16-BH015
Pathway
kit00473  D-Alanine metabolism
kit00550  Peptidoglycan biosynthesis
kit01100  Metabolic pathways
kit01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:kit00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    CFP65_5118
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CFP65_5118
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    CFP65_5118
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:kit01011]
    CFP65_5118
Enzymes [BR:kit01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     CFP65_5118
Peptidoglycan biosynthesis and degradation proteins [BR:kit01011]
 Precursor biosynthesis
  Amino acid ligase
   CFP65_5118
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: AUG79829
UniProt: A0A2H5B612
LinkDB All DBs
Position
5978641..5979792
Genome map
AA seq 383 aa AA seqDB search
MSIEQNTPHPGASGAVKPRVAIVFGGRSSEHGVSVSTAASVFAAIDRTKYEVLPVGITHE
GRWALVQEPSGISLAAGNVPDVEQIAESAEGQLALPGYPAVREVLWSEPGATPKALGEVD
VVLPLLHGPWGEDGTLQGLLELSGVPYVGSGVLASAVGMDKEYTKRLLESNGLYVGEYTV
IRPRDWEGEAGRAAARERVAALGLPVFVKPCRAGSSIGITKVKDLADLDGAIEEARRHDP
KVIVERGVAGREIECGVLDTPEGPKASLPAEVLVGGDFEFYDFEAKYVDSSEVQIPAALT
EAETAEIRRQALIAFEALSCEGLARVDFFLLEDGRWMVNEINTMPGFTPISAYPKMWEAT
GLPYAELIDRLLTAALSRSTGLR
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgagcatcgaacagaacaccccgcacccgggcgcttcgggcgccgtcaagccgcgcgtc
gcgatcgtcttcggcggacgcagctccgagcacggcgtctcggtctccacggccgccagc
gtgttcgccgcgatcgaccgcaccaagtacgaggtgctgccggtcggcatcacccacgag
ggccgctgggcgctcgttcaggagccgagcgggatctcgctggcggcgggcaacgtcccc
gacgtggagcagatcgccgagtccgccgagggccagctcgcgctgccgggctacccggcc
gtccgcgaggtgctctggtccgagcccggcgccacgccgaaggcgctcggcgaggtggac
gtggtgctgccgctgctgcacggcccctggggcgaggacggcaccctccagggcctgctg
gagctctccggcgtgccgtacgtcggctccggcgtgctggccagcgcggtcgggatggac
aaggagtacaccaagcgcctgctcgaatcgaacgggctgtacgtcggcgagtacaccgtg
atccgcccgcgcgattgggagggcgaggccggccgggccgccgcccgcgagcgggtggcc
gcgctcggcctgccggtcttcgtcaagccctgccgggccggctccagcatcggcatcacc
aaggtcaaggacctggccgacctggacggcgcgatcgaggaggcccgccgccacgacccc
aaggtgatcgtggagcgcggggtggccggccgggagatcgagtgcggcgtgctcgacacc
cccgagggcccgaaggccagcctgccggccgaggtgctggtcggcggcgacttcgagttc
tacgacttcgaggccaagtacgtcgactcctccgaggtgcagatcccggcggcgctgacc
gaggccgagacggccgagatccgccgccaggccctgatcgccttcgaggcgctcagctgc
gagggcctggcccgggtggacttcttcctgctggaggacggccgctggatggtcaacgag
atcaacaccatgcccggcttcacccccatctcggcctacccgaagatgtgggaggccacc
ggcctgccgtacgcggagctgatcgaccgcctgctgacggccgcgctgagccggtctacc
ggcctgcgctga

DBGET integrated database retrieval system