KEGG   Kitasatospora sp. MMS16-BH015: CFP65_7211Help
Entry
CFP65_7211        CDS       T05366                                 

Definition
(GenBank) beta-galactosidase
  KO
K12308  beta-galactosidase [EC:3.2.1.23]
Organism
kit  Kitasatospora sp. MMS16-BH015
Pathway
kit00052  Galactose metabolism
Brite
KEGG Orthology (KO) [BR:kit00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    CFP65_7211
Enzymes [BR:kit01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     CFP65_7211
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_42 Glyco_hydro_42M Glyco_hydro_14 DUF4159
Motif
Other DBs
NCBI-ProteinID: AUG81805
UniProt: A0A2H5BBL7
LinkDB All DBs
Position
complement(8428788..8430773)
Genome map
AA seq 661 aa AA seqDB search
MDIHRLTDRLGGLAFGGDYNPEQWDAEVWKQDDELMRLAKVNLATVGVFSWALLEPEEGR
YDFAWLDAHLDRLHLNGVAVDLATPTASPPPWFTLAHPDALAVRPDGLRLTHGSRDTYCL
AAPAYRQAAARIAGALAERYGDHPALALWHVHNEYATLCWCDHTAAAFRVWLRDRHGDLD
ALNHAWGTAFWSQHYTAWEQILPPRATQWHHNPGQALDFSRFWSDQTLAAYREQRDAIRA
RSDRPVTTNLMLPGYQNLDLWAFGREVDLVSVNHYPGAPGVDAAAQAAFDADRARSFAGG
APWLLMESGTNTVYAGGRTLAKEPGDVLRHSLGHIARGSEGALFFQWRQSKAGAEQWHSA
MVPHAGPDSRTFREVTALGESLARLGELAGSTVRAEVAVLHDPDAWWAMNVDGLPSAELD
YFTALRRAHRALWDAGATVDFAHPGQSLAGYRLVLAPALFLLTDASAENLRHYVAGGGTL
LVQHFSGVVDEHLHSRLGGYPAAPLREALGIRVEEYRPLAEGERITLSDGSTATVWSESL
RTEGAEAVAAYTHGMLAGRPALTRHPFGTGHGWYLSSRLDDSGYAGLVGRLLTEAGVTAG
LPGLPPGVEAVTRHAPDGRRWHLLISHRDEAVPLPEPGRDLLTDRFLSELPPGGCAVLRA
H
NT seq 1986 nt NT seq  +upstreamnt  +downstreamnt
atggacatccaccggctcaccgaccgcctcggcggcctcgccttcgggggcgactacaac
cccgagcagtgggatgccgaagtctggaagcaggacgacgagttgatgcgcctggccaag
gtcaacctggccaccgtcggcgtcttctcctgggccctgctcgaacccgaggagggccgc
tacgacttcgcgtggctcgacgcccacctcgaccgtctgcacctgaacggcgtcgccgtc
gacctggccacccccaccgcctccccgccgccctggttcaccctggcccacccggacgcc
ctcgccgtccggcccgacggcctccgcctgacccacggcagccgggacacctactgcctc
gccgcccccgcctaccggcaggccgccgcccggatcgccggcgccctggccgaacgctac
ggcgaccaccccgcgctcgccctgtggcacgtccacaacgagtacgcgaccctgtgctgg
tgcgaccacacggccgccgccttccgggtctggctgcgcgaccggcacggcgacctcgac
gccctcaaccacgcctggggcacggccttctggagccagcactacaccgcctgggagcag
atcctgccgccgcgcgccacccagtggcaccacaaccccgggcaggccctggacttcagc
cgcttctggtccgaccagaccctcgccgcctaccgcgagcagcgcgacgcgatccgcgcg
cgcagcgaccgcccggtgaccaccaacctgatgctgcccggctaccagaacctcgacctg
tgggccttcgggcgcgaagtcgacctggtctcggtgaaccactaccccggcgccccgggc
gtcgacgccgccgcccaggccgccttcgacgccgaccgggcccgctccttcgccggcggc
gcgccctggctgctgatggagtcgggcacgaacaccgtctacgccggcggccgcaccctc
gccaaggagccgggcgacgtcctgcgccactcgctgggccacatcgcccgcggttcggag
ggcgcgctgttcttccagtggcgccagtccaaggccggcgccgagcagtggcactccgcg
atggtcccgcacgccgggccggacagccgcaccttccgcgaggtcaccgccctgggcgag
tccctggcccggctcggtgagctggccggctccacggtccgcgccgaggtcgccgtgctg
cacgacccggacgcctggtgggcgatgaacgtggacgggctcccctccgccgagctcgac
tacttcaccgcgctgcgccgcgcccaccgggcgctctgggacgcgggcgccaccgtcgac
ttcgcccaccccgggcagagcctggccggctaccggctggtcctcgccccggccctgttc
ctgctcaccgacgcgagcgccgagaatctccgccactacgtggcaggcggtggcaccctg
ctcgtccagcacttcagcggcgtggtcgacgagcacctccactcccggctcggcgggtac
ccggccgcaccgctgcgcgaggcgctgggcatccgggtcgaggagtaccgcccgctggcc
gagggcgagcggatcaccctgtcggacggctcgacggccaccgtctggagcgagtcgctg
cgcaccgagggcgccgaggcggtggcggcctacacccacggcatgctcgccggccggccc
gcgctcacccggcaccccttcggcaccggccacggctggtacctctccagccggctggac
gactccggctacgccggtctggtcggccggctgctcaccgaggccggcgtcaccgccgga
ctgcccggcctgccacccggcgtcgaggccgtcacccgccacgccccggacggccggagg
tggcacctgctgatcagccaccgcgacgaggccgtcccgctcccggagcccggccgggac
ctgctcacggaccggttcctcagcgaactcccgcccggcggctgcgccgtcctgcgcgcg
cactga

DBGET integrated database retrieval system