KEGG   Kingella kingae: KKKWG1_0250Help
Entry
KKKWG1_0250       CDS       T04151                                 

Gene name
gyrA
Definition
(GenBank) DNA gyrase (type II topoisomerase), subunit A
  KO
K02469  DNA gyrase subunit A [EC:5.6.2.2]
Organism
kki  Kingella kingae
Brite
KEGG Orthology (KO) [BR:kki00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:kki03032]
    KKKWG1_0250 (gyrA)
   03400 DNA repair and recombination proteins [BR:kki03400]
    KKKWG1_0250 (gyrA)
Enzymes [BR:kki01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.2  DNA topoisomerase (ATP-hydrolysing)
     KKKWG1_0250 (gyrA)
DNA replication proteins [BR:kki03032]
 Prokaryotic type
  DNA Topoisomerases
   KKKWG1_0250 (gyrA)
DNA repair and recombination proteins [BR:kki03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHIIR (short-homology-independent illegitimate recombination)
     Facilitator
      KKKWG1_0250 (gyrA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_topoisoIV DNA_gyraseA_C
Motif
Other DBs
NCBI-ProteinID: CRZ19426
UniProt: A0A0P1D0N3
LinkDB All DBs
Position
I:complement(221802..224531)
Genome map
AA seq 909 aa AA seqDB search
MSSANDQQFAKETIAVSLEDEMKKSYLDYAMSVIVGRALPDVRDGLKPVHRRVLYAMHEL
KNNWNGAYKKSARVVGDVIGKYHPHGDSAVYQTIVRMAQPFSMRYTLVDGQGNFGSVDGD
AAAAMRYTEIRMEKIAHEMLADIEEDTVNFGDNYDGSEREPLVLPTRFPALLVNGSEGIA
VGMATSIPPHNLRDTLAGCLKLLREPETDINDLIDIIKAPDFPTGATIYGLTGIRAGYHT
GRGRVVIRSKTHIEPIGKNGEREAIIVDEIPYQVNKSKLVEKIGDLVRDKAIEGIAELRD
ESDKDGTRIVIELKRNENAEVILNQLYKLTQLQDTFGINMVALVDGQPRLLNLKQILSEF
LRHRREVVTRRTLFRLKKARAEGHIAEGKAVALSNIDEMIALIKQSADVETAREALLGRA
WQSALVSEMLSRSDLDLSMARPEWLPENRGLQADGYWLSDEQARAILRMSLRNLTGLDQD
EIVKEYKDLMAVIMDLLDILAKPERVRQIIDDELVAMQTQFGDERKSEINAVGGGDIADE
DLIPPREMVVTLTHGGYIKTQPTSDYQAQKRGGRGKQAAATKDEDFIETLFVANTHDYLM
CFTNLGKCHWIKVYRLPEGGRNSRGRPINNVIQLEENEKVSAILPVRDFPEDEYVFFATA
LGVVKKVQLSAFKNVSVKGIKAIALKGGDSLVGVAKTSGSSDIMLFSNLGKAIRFNEFYN
PSSSDDDESEDVSGSLNDENSADDDNSSEFNLLTNKGIRPSGRGSGGLRGMKLPENGRIV
SLLVAELGSDLQVLTATQNGYGKRTPIEDYSRKGKGGQGIIAIDTGERNGELVGAALVSP
SDDLMLITSGGVLIRTKVEQIRETGRAAAGVKLINLDEGTTLVSIERVAESDDDGDTVDD
VVADAVIVE
NT seq 2730 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcgcaaacgaccaacaatttgccaaagagaccatagcagttagcctagaagac
gaaatgaaaaagtcctatttggactacgccatgtcggtgattgtgggacgtgcgttgccc
gatgtgcgcgatggcttgaaacccgtccaccgccgcgtgttgtacgccatgcacgaattg
aaaaataactggaacggcgcgtacaaaaaatccgctcgcgtggtcggtgatgtgattggt
aaataccacccacacggcgacagcgcggtttaccaaaccatcgtgcgcatggcacaacca
ttttccatgcgctacacgctggtggacggtcaaggtaacttcggttcggtagatggcgac
gcggcggcggcaatgcgttacaccgaaatccgcatggaaaaaatcgcccacgaaatgctc
gccgacattgaagaagacacggttaattttggcgacaactacgacggcagcgaacgcgaa
ccgcttgttttgccaactcgttttcctgcgctgctcgtgaacggctcggaagggattgcg
gtcggcatggcaaccagcattccgccccacaatttgcgcgacacgcttgcaggctgcctg
aaacttttgcgcgaacccgaaaccgacatcaacgatttaattgacatcatcaaagccccc
gatttcccaactggggcaacgatttacggcttgacaggcattcgcgctggctaccacaca
gggcgcggtcgtgtcgtgattcgcagtaaaacgcatattgaaccgattggcaaaaatggc
gaacgtgaagcgattattgttgatgaaattccgtatcaagtgaataaatccaaactcgtt
gaaaaaattggcgatttggtgcgcgacaaggcgattgaaggcattgcggaattgcgcgat
gagtcggacaaagacggcacgcgcattgtgattgagttgaaacgcaatgaaaatgcagaa
gtcattttaaatcaattatataaactcacgcagttgcaagacacgtttggcatcaatatg
gtggcgttggtggacggtcagcctcgtttgttgaatttgaaacagattttgagcgaattt
ttacgccatcgccgtgaagtggttacgcgcagaacgctgtttcgcttgaaaaaagcgcgt
gcagaaggacacatcgcagaaggtaaagcggttgccctatccaatattgatgagatgatt
gcgctgattaagcagtcggcggacgtggaaacggcgcgtgaagcgttgctcggtcgcgct
tggcaatcggctttggtgagcgaaatgttgtcgcgctcggatttggatttgagcatggcg
cgtcctgaatggctgcctgaaaatcgcggtttgcaagcagacggttattggttgagcgat
gagcaagcgcgtgcgattttgcgtatgagtttgcgaaatttgactggtttagaccaagac
gaaattgttaaagaatataaggatttaatggcggttatcatggatttattggatattttg
gcgaaacctgaacgtgtgcgccaaattattgacgatgaattggtggcgatgcaaacgcag
tttggcgatgagcgcaagagtgaaatcaatgcggtgggcggtggcgatattgccgatgaa
gatttgattccgccacgtgaaatggtggttacgctgacgcacggcggctacatcaaaacg
cagccgactagcgattatcaggcgcaaaaacgcggtgggcgcggcaaacaagcggcggca
accaaagacgaagattttattgaaacgctgtttgtggcgaacacgcatgattatttgatg
tgtttcacgaatttgggcaaatgccattggattaaggtttacaggctgcctgaaggtggg
cgcaattcgcgcggtcgtccgattaacaatgtgattcagttggaagaaaacgaaaaagtg
agtgcgattttgcctgttcgtgatttccctgaagatgaatatgtgttctttgcgactgcg
ttgggcgtagtgaaaaaagttcaactgtcggcatttaaaaatgtgagcgtgaagggcatt
aaggcgattgcgttgaaaggcggcgacagcttggtgggtgtggcgaaaacgtcgggttcg
tctgatattatgttgtttagcaatttgggtaaggcgattcgtttcaatgaattttacaat
ccgagtagcagcgatgatgatgaaagcgaagatgtttcaggcagcctgaatgatgaaaat
tcagctgatgatgataattctagcgaatttaatttgctgacgaataaaggtattcgccca
agtggtcgtggttcgggcggtttgcgcggtatgaagctgcctgaaaatggtcgcattgtg
agtttgttggtggcggaattgggtagcgatttgcaagttttgaccgctacgcaaaacggc
tacggcaaacgcacgccgattgaagattactcgcgcaaaggcaaaggcggtcaagggatt
attgcgattgatactggcgaacgtaacggtgaattggtgggcgcagcgttggtgtcgcct
agcgatgatttgatgttaatcacatcgggcggcgtgttaatccgcaccaaagtggagcag
attcgtgaaacaggacgtgcggcggctggcgtgaagctcatcaatttggacgaaggcacg
actttggttagcattgaacgtgttgccgaaagtgatgatgacggcgatacggttgatgat
gttgtcgccgatgcggtaatcgtagagtaa

DBGET integrated database retrieval system