KEGG   Kingella kingae: KKKWG1_0355Help
Entry
KKKWG1_0355       CDS       T04151                                 

Definition
(GenBank) Ribonuclease II
  KO
K01147  exoribonuclease II [EC:3.1.13.1]
Organism
kki  Kingella kingae
Brite
KEGG Orthology (KO) [BR:kki00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:kki03016]
    KKKWG1_0355
Enzymes [BR:kki01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.13  Exoribonucleases producing 5'-phosphomonoesters
    3.1.13.1  exoribonuclease II
     KKKWG1_0355
Transfer RNA biogenesis [BR:kki03016]
 Prokaryotic type
  3'processing and CCA adding factors
   3'processing factors
    KKKWG1_0355
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNB
Motif
Other DBs
NCBI-ProteinID: CRZ19530
UniProt: A0A0P1D0I4
LinkDB All DBs
Position
I:322055..323944
Genome map
AA seq 629 aa AA seqDB search
MSHIFYEDGGQFKVASIVQKNDSTYQADTQHGKRVKVKAANTFIEFDGSMDSFMQTAQAE
ANEIDTELLWDCVGQDEFDFKAAAKEYFGNQASKTQLAATLMALYAAPMYFHKKNKGVFK
AAPEDVLKQVLATIERKAQQEAQIQAWADEMVAGRLPDAITTELPQILYDPDKQSLAYKA
FHKASDALKLSPYELALHTGGITSKPQYLLQRFAYKYFPKGMDFPELSAPEQPAHLPLAN
VQAFSIDDLSTTEVDDALSVQDLGNGSKRIGIHIAAPALGIEPNSDVEKIVMQRLSTVYF
PANKITMLPENWIGAFSLDEGKVVPAFSIYFDVDENWQLSEPTSQIELVPIATNLRIQNI
EPFFNSETGVGSADNPQFAHHADCLYLLDLACELQRQRDRLDDPTLPKKYDYGIDFDANG
KVLITRRERGSPIDTLVSEMMILANTSWAKMLHDNELAGLFRVQPSGRVRMSTHSEPHIG
MNVAHYGWFTSPLRRASDYINQKQLQSLLDPDSEPRFTKNDSDLFVALGAFEAAFNAYRA
FQDTMENYWATVWLVQENVREINAVVLKEDLVRLESLPLTARATGIPIEIAPKATVKLAI
TEIDPEQQFIALKYLSVVPTATTVVVDEE
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atgagccatattttttatgaagacggcggacaattcaaagtcgccagcatcgtgcaaaaa
aacgatagcacctatcaagccgacacgcaacacggcaagcgcgtcaaagtcaaagccgcc
aacacgtttattgaatttgacggcagcatggacagcttcatgcaaaccgcccaagccgaa
gccaacgaaatcgacaccgaattgctgtgggactgcgtagggcaagacgaattcgacttc
aaagccgccgccaaagaatattttggcaaccaagccagcaaaacccaattagccgcgact
ttgatggcgttgtatgctgcgccaatgtattttcacaaaaaaaacaaaggcgtgttcaaa
gctgcacccgaagacgtactcaaacaagtcctagccacgattgaacgcaaagcgcaacaa
gaagcgcaaatccaagcatgggcagacgaaatggttgcaggccgcttgcccgatgccatt
accaccgaattgccgcaaattttgtacgaccccgacaagcaatcgttggcatacaaagca
ttccacaaagccagcgacgcgctgaaattgtcgccctacgaactggcgttgcacacaggc
ggcatcacgtccaaaccacaatatttgttgcaacgctttgcctacaaatatttccccaaa
ggcatggattttcccgaattatccgcaccagagcagcctgcacatttgccgcttgccaac
gtacaagccttttccattgacgacttatccacaaccgaagtcgatgacgcgctgtcggtg
caagatttgggcaacggcagcaagcgcatcggcatccacatcgctgcccccgcgctgggc
atcgagccgaatagcgatgtagaaaaaatcgtcatgcagcggttaagcacggtgtatttt
cctgccaacaaaatcaccatgctgcccgaaaactggattggcgcgttcagcttggacgag
ggcaaagtcgtgccagcgttcagcatttattttgatgtagatgaaaattggcagttatcc
gagccaaccagccaaattgagcttgtgccaatcgccaccaatttgcgtattcaaaacatc
gaaccattttttaatagcgaaacaggcgtaggcagcgcggataatccacagtttgcccac
catgccgattgcttgtatttgctggatttagcgtgcgaattgcaacgccagcgcgaccgt
ttggacgaccccactttgcccaaaaaatacgattacggcattgattttgatgccaacggc
aaagtgctgattacgcgccgtgaacgcggttcgccgattgacacgctggtcagcgaaatg
atgattttggcgaacacatcgtgggcaaaaatgctgcacgataacgaattggcaggttta
ttccgcgtgcagccgagcggtcgcgtgcgaatgtccacgcattccgagccgcacatcggc
atgaatgtggcgcattatggctggtttacttcgccgctgcgccgtgccagcgactacatc
aaccaaaagcaactgcaaagcctgctcgacccagacagcgagccacgttttaccaaaaac
gacagcgatttatttgtggcattgggcgcgtttgaagccgcgtttaacgcctatcgcgcg
tttcaagacacgatggaaaactactgggcaaccgtgtggctggtgcaagaaaacgtgcgc
gaaatcaatgctgtggtgctaaaagaagacttggtgcgcttggaaagcttgccactaacg
gcacgcgccactggcattccaatcgagattgcgcccaaagccaccgtcaagctggcgatt
accgaaatcgaccccgaacagcaatttatcgcgctgaaatatttgtcggttgtgccaacc
gcgacaacggttgtggtagatgaagagtga

DBGET integrated database retrieval system