KEGG   Kangiella koreensis: Kkor_0140Help
Entry
Kkor_0140         CDS       T00973                                 

Definition
(GenBank) alkyl hydroperoxide reductase, F subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
kko  Kangiella koreensis
Brite
KEGG Orthology (KO) [BR:kko00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Kkor_0140
Enzymes [BR:kko01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Kkor_0140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA HI0933_like DAO FAD_binding_2 Thi4 FAD_oxidored AlaDh_PNT_C Lycopene_cycl NAD_binding_7 NAD_binding_8 Thioredoxin_9 Thioredoxin_4 Glutaredoxin ABC_transp_aux FAD_binding_3 3HCDH_N K_oxygenase
Motif
Other DBs
NCBI-ProteinID: ACV25561
UniProt: C7R6P5
LinkDB All DBs
Position
complement(139634..141244)
Genome map
AA seq 536 aa AA seqDB search
MLNNQILEALKGYTAKMQKTVTFVLQTGEHSKRNELKEFLSSFVSVSDKLQLEERDLSGQ
VRSPISFILEADEQDTGITFSGIPSGHEFNSLVLAVLQAAGSPVKLDESLKKMVANVQQE
MKFEVFISLSCHNCPDVVQALNQFALLNPNISAEMIDGGLFQDMVKARDIQGVPSVYLNG
ELFANGKVTAAELIDKLLEKDPSIAQAGPSEKMPLQDVVVIGGGPAGVGSAIYSARKGLK
VTLIADRIGGQVKDTMGIENLISVPKTTGPELSGALQAHLNDYDVTVKEHLRVTNIEQGD
IKSITLSSGEVIDSKTLIIATGAKWRELGIPGEKENIGNGVAYCPHCDGPFFKGKDVAVI
GGGNSGIEAALDLAGIVKSVTVFEFMPELKADKVLVDQAEARDNITILRNVATKEIHADN
GKVSAIEYQDRVTEANHSLKLDGVFVQIGLVPNSKFLGDVVELTRFGEVVINEKCETSQP
GIYACGDVTTVPYKQIVVAMGEGAKASLASFEYLLANSSRLDAMYQNHQTSQSAAA
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atgttgaacaatcaaattttagaagccttgaaaggctataccgccaagatgcaaaagacg
gtgactttcgttttgcaaaccggtgagcattcaaagcgaaatgaacttaaagaattttta
agcagctttgtcagcgtaagcgacaaactgcaacttgaagaacgtgacctgtccggtcag
gttcgcagtccgatcagcttcattcttgaggcagatgagcaggacacgggtattactttc
tcaggaatcccatccggccatgagtttaactcattggtattggcggtattacaggctgct
ggcagtccagtgaagcttgatgaatccctgaagaaaatggttgccaatgtgcagcaggaa
atgaagttcgaagtctttatcagcctgagctgccacaactgtcccgacgttgtgcaggcc
ctgaatcagtttgcactgcttaatccaaatatcagcgcagaaatgattgacggtggcctg
ttccaagacatggttaaagcacgtgatattcagggcgtgcccagtgtttatcttaacggt
gaactcttcgccaacggtaaagttactgccgcagaattgattgataagttgctggagaaa
gatcccagcattgcgcaagcaggtcccagcgagaaaatgccattgcaggatgtggttgta
attggcggtggcccagcaggtgtcggctcggcaatttatagtgcccgcaaaggcttaaaa
gttacccttattgcggatcgaatcggtggtcaggtcaaggacactatgggaattgaaaac
ctgatttctgtgcctaaaaccactggccccgaattatccggtgctttgcaggcgcacttg
aatgattatgacgttaccgtcaaagagcatctgcgtgtgactaacattgaacaaggtgat
atcaaaagtatcaccctgtcatcaggtgaagtgattgacagtaaaaccttaatcatcgcc
accggtgctaaatggcgtgaactgggcattcccggcgagaaagaaaacatcggtaatggt
gttgcttactgcccacactgtgatggtcctttcttcaaaggaaaagatgtcgcagttatt
ggtggcggtaactcaggcattgaagccgcgctggatttggcgggcattgtaaagtcagtg
accgtattcgagtttatgccagaactgaaagcggacaaggtattggtcgatcaggcagaa
gcgcgtgacaacatcaccattctgcgtaatgtcgccaccaaagagattcatgccgacaac
ggtaaggtatcagcgattgaatatcaggaccgagtgacagaagcgaaccacagtttaaaa
ctggatggcgtttttgtgcagattggtctggtgccaaacagcaagttcttaggcgatgtg
gttgagctgacacgttttggtgaagtggtcattaacgagaagtgtgaaacttcacagccc
ggtatctacgcttgcggagacgtgacgactgtaccttataagcaaatcgtggtggccatg
ggcgaaggcgctaaagcgtcactggcgtcctttgaatacctgctggctaattcatcgaga
cttgatgccatgtatcaaaatcatcaaaccagccagtcagcagcagcatag

DBGET integrated database retrieval system