KEGG   Kangiella koreensis: Kkor_0202Help
Entry
Kkor_0202         CDS       T00973                                 

Definition
(GenBank) serine/threonine protein kinase
Organism
kko  Kangiella koreensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Pkinase_fungal
Motif
Other DBs
NCBI-ProteinID: ACV25623
UniProt: C7R6V7
LinkDB All DBs
Position
208025..209071
Genome map
AA seq 348 aa AA seqDB search
MLNTTRTAELSFHIVKEVGQEGKNSTVFTATDLQLNAEIVVKKMLKSDFEDIDEYFTESS
LLYLSSHPNVVPIYYACQDDEHIFLAMPYFKNGSLKRIIQNTSISVREMIVWSTQVLSGL
HNIHSKNLIHFDIKPDNILFSDRGEALLSDFGLAKQISFSGTAEQDRIYGNMVPPEAFNT
GSFNHQFDIYQFGLTLHRMCVGDASFYAEYSSFVEDGVLNRNRYRHAVISGQFPGRDNYP
EHIPQALVTTIKRCLAIEPSNRYASAIDVVNDIAGIDGNLLDWRLSHEGGIRKWRKQDTD
GRCFELSIELDGGALASKTSAKGNTQRIAEYCKPELTRADVKRFLRRY
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgcttaatacaacacgaactgctgaattaagttttcatatagttaaggaggttggtcag
gaagggaaaaactctactgtgtttacagcgactgatctgcaactaaatgcagaaattgtt
gtaaaaaaaatgttgaagtcggattttgaagatatagatgaatatttcacagagtctagt
ctattatatttgagcagtcacccaaatgtagtcccaatttattatgcgtgccaagatgat
gagcatatctttcttgccatgccgtattttaaaaacggttcacttaagagaataatacaa
aatacttcaattagtgttagagagatgatcgtttggtcgactcaggttcttagtgggcta
cataatattcactcaaaaaacttaatccactttgatattaaaccagataatatcctcttc
tcggatagaggagaggcgcttttatccgactttgggttagctaagcaaatttcatttagc
ggtacggctgagcaggatagaatatacgggaatatggttccccccgaggcttttaatacg
ggaagttttaatcaccagtttgacatatatcaatttgggctaacgcttcacagaatgtgt
gtaggggatgcgtcattttatgcagaatattctagttttgtggaagacggagtattaaat
cgcaatagatacaggcatgctgtcattagtggacagtttccaggcagagataactaccca
gagcatattcctcaggcattagtaactactattaagaggtgtttagctatagagcctagc
aatagatacgcttccgcgatagatgtcgtcaatgatatagctggtattgacggtaatctc
ttagactggcgattgtctcatgagggaggtattcgaaagtggcgtaagcaagatactgat
ggtcgttgttttgagctaagtattgagcttgatgggggggcgttggcaagtaaaacatcg
gctaaaggaaatactcaaagaatagcagagtattgcaagcctgagctaactcgagcagat
gtaaagcgtttccttaggagatattag

DBGET integrated database retrieval system