KEGG   Kangiella koreensis: Kkor_0230Help
Entry
Kkor_0230         CDS       T00973                                 

Definition
(GenBank) CheA signal transduction histidine kinase
  KO
K02487  type IV pili sensor histidine kinase and response regulator
K06596  chemosensory pili system protein ChpA (sensor histidine kinase/response regulator)
Organism
kko  Kangiella koreensis
Pathway
kko02020  Two-component system
Brite
KEGG Orthology (KO) [BR:kko00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Kkor_0230
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:kko01001]
    Kkor_0230
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:kko02022]
    Kkor_0230
   02035 Bacterial motility proteins [BR:kko02035]
    Kkor_0230
Protein kinases [BR:kko01001]
 Histidine kinases
  CheA family [OT]
   Kkor_0230
Two-component system [BR:kko02022]
 CheA family
  ChpA-ChpB/PilGH (chemosensory)
   Kkor_0230
Bacterial motility proteins [BR:kko02035]
 Pilus system
  Twitching motility proteins
   Kkor_0230
  Chemosensory pili system proteins
   Kkor_0230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hpt Response_reg CheW HATPase_c H-kinase_dim HATPase_c_3
Motif
Other DBs
NCBI-ProteinID: ACV25651
UniProt: C7R7A2
LinkDB All DBs
Position
235124..241765
Genome map
AA seq 2213 aa AA seqDB search
MRDNQTKVALNWVKDEVESTLEQAQNAIKAYAEDESDKTQIHFCANCMHQIRGTMQMLEF
SGAALLAEEMEALAEAIGERKVESNEKAYEVFLSAILRFRSYLSRYAEGKSDLPVILLPA
INDMRICRGADNLGAGNLISIPTEGIDAPSPKNKTELKGDILAEVKALRSKFQQGLLGVI
RDVEVQANMEQMREVTESLWGLENRVPYQPLWWVASTFLKNIGLLPKKDNPVVKSLLGQV
DRRIRELIEQTANQEEANKVLINILFYVAQFDTEDEQVKEVQDKFQLNQLMDSLGDLESE
SSDLTGPDTASVRIALNVIKEDLGEIKESLDLYIRTKSQESEPLEDMIPAMQKISDTMSM
LGLTQSKEMISKQMGSIGDLLDGSEADREQGLIYIAEGILSLEDYIERALKMDSKQLANE
SLGQGEGESLQIINARYQLVQESRGNLHKVKDAITDYLDESHNINRLENVPELLKEVEGA
LTFAQLDTLLDVITKSKNFVVKYLISEKVVLSDAEVSTLADAISSVDYYLEGLMSSGLHG
LPVILQRAIDSISELEEHYGNLDEELLPVLDEPLEMPEIEMVESENHDQDDDSDELIDDE
VREIFIEEADEVLEEMHSLLPEWKQDQTNKEAINTIRRNFHTLKGSGRMVGATDIGELSW
AIENMLNRLLDHSIEYSPALFVTTEEVANILPKMVKQFAGGERTQYPRDLAERANRISKG
EIITDIQPHQEQTEEEADQAAEQELFDIFKQEAEGHVTNLEMFANQRQQGITQSQISDNL
LRSLHTLKGVAHIANIQSLTNVIVPVESYFQELKTRELLAEEGDMALIDHTKDLLRYIIS
TPEDDQVISVHEDEILQQLSKQQKRFDESGETIQEQGRDPELIKDIFNIASDVLVDIEST
NLQETPEKERLEKISYLMASVDRLKSILGEAELNEIEQVVSALSDALQRNMTASKVDTSI
GVLLNETYNQLENQFDCLAANLSITEASDLVQALQTWSPAEATAGLELELEPATGEAAAK
DESSSEVESGLESSDETSAAIPAEESSEPEEKQATEDNSIEFSLDDDFLTTKPEDKQEEK
DTSFEEKATSDDNSIEFEFSDDFLASEPAEEESSTEEIEDDSDISLEDAAEELGLDLSED
LDLSDELDSDETSEVTEETSHEEVQQKETAGEDSLEYNFEELDETAETTETTEDVVSKQE
EPLEADELADQDEAATTEEKTGEIIEEAPEEETSQAVEEEPRKESAKTISLDLDVDDELL
EIFSEEAEELFDSDAALLQKWRQEPNNVKIIAELQRNLHTLKGSARMAGFSPIGDLAHGL
EDLYTAITDQLFAASDQAIDLAERAEDQLLAIFNARNTPDQIPSPAAMLDEIQGFISAQK
AGRAYVRPQAEDIKPTEIVEEPQQPVEEAKTESPKEENKAEEPEQIKTEEPTQDKGALEE
AAWNEELAELFLGEASELLSSYEEAIERWSGDLHNTQPLNSAMRNLHTLKSGAKLAAITP
IGELTHKLEGLVEALARDPRLGNSRWADVLRRSYDQLHEMVEQVRNGHMPEKPAELLRKL
ESDKATIESQLDQLDKRDLAESGEQAEVKVVSLADRQKQKEEAAKEAANRDVIRVRSEVL
DNLVNLSGEASIFRSRLEQQVADLNFNLKEMSSTVDRLREQLRNLEIETEAQVLYRREIS
GVDFDEFDPLEMDRYTRQQELTRSLLEAASDLMSIQETLETKVGDAEATLLAQGRVNTEL
QDRLMRTRMVPFNSIESRLRRMVRQISTELNKDVDLILESEGEMDRTVIERMVAPLDHML
RNAIDHGIESKTERKKAGKVEKGTVHLSLSRRGNEVYIQIQDDGAGIRKDKVRARAISQG
MIDESYNPTDRELFRLILQPGFSTAETVTQISGRGVGMDVVHSEILQLGGSLNISSEEGQ
GTTMTVRLPFTLSSNQALMVRVKGEPYAIPLSNITTVARVSAKEVLEIYQDKDKTFSHLG
EEFELRYLGQILDRNSDIIPPVDEYVPVLIIQGEDKPIAVHVDELIGSREIVVKNIGRQI
STVPGISGASILGDGSVVLILDMQTLVDRFHEWDFAHEAGMVQEAPVENRIPIVMVVDDS
ITVRKVTARLLQRNQFQVMTAKDGVDAITQLHDDIPDVMLLDIEMPRMDGFELATIIRHD
ERLKHLPIIMITSRTGEKHRERAEQIGVNRYLGKPYNEEALLGTIDEMLKLED
NT seq 6642 nt NT seq  +upstreamnt  +downstreamnt
atgagagataatcaaacaaaagtagctttaaattgggttaaagacgaggttgaaagcacg
cttgagcaagcgcaaaatgcgataaaagcgtacgcagaagacgagtctgataagacccaa
atacatttctgtgcaaattgcatgcaccagatccgaggcactatgcaaatgctagagttt
tctggcgcagcattactggcggaagaaatggaagcactagccgaagctatcggcgaaaga
aaagttgaatcaaatgagaaagcctatgaagtctttctttctgccattttaagattccgt
agctacttatcacgttatgctgaaggaaaatctgatctacctgttattttactgcccgcc
ataaacgatatgcgtatctgtcgtggtgctgataatctgggtgcaggcaacctgatcagt
attccaaccgagggtattgatgctccttcgcctaaaaacaagacagaacttaaaggtgat
attttagccgaagtcaaagcgcttcgttccaagttccaacaaggattgcttggggtcata
agagacgttgaagtgcaagccaacatggagcagatgcgtgaagtcacagagtccttatgg
ggactggagaatcgtgttccataccaacctctttggtgggttgcttcaaccttcctaaaa
aatattggtctacttcctaagaaagataatcctgttgtaaaaagtttactgggtcaagtt
gaccgtcgtatccgtgagctaatagagcaaacggctaatcaggaagaagctaataaagtt
ttaattaatattctgttctacgttgctcaatttgatacagaagatgagcaagtgaaagaa
gtacaagataaattccagctaaatcaattaatggattctttaggtgatcttgaaagtgag
tctagtgatttgactggccctgatactgcgagtgttcgaattgctctcaacgttatcaag
gaagatcttggtgaaatcaaagagtcgcttgatctttacattcgaactaaatctcaggaa
agcgaaccactggaagatatgattccagcaatgcagaaaatttcagacactatgtcgatg
cttggtttaacacaatccaaagagatgataagcaagcagatgggctcgattggtgacttg
ctggatggctctgaagctgatcgcgaacagggtctgatatatattgccgagggaatcttg
tcactggaagactacattgagcgtgcgctaaaaatggatagtaagcagcttgctaatgaa
agccttggtcaaggcgaaggggagtcattacagataattaatgccagatatcagttggtt
caagaaagtcgcggcaacttgcataaagttaaagatgcaattactgattatctagatgaa
agccataatattaatcgccttgagaatgttcctgaattattgaaagaagtagagggtgct
ttaacttttgcccagcttgatacactattagatgtgatcaccaagtcaaaaaactttgta
gtcaaataccttattagtgaaaaagtcgtattaagcgatgctgaggtttcaacgctggct
gatgcaataagctcagttgattattaccttgaaggactgatgtcatctggactgcatggc
ttaccagtgatcttacagcgagccattgatagtattagtgagctggaagagcactacggc
aacctggatgaagagctgctaccagtcttggatgagccgcttgaaatgcctgaaatcgaa
atggttgaaagtgagaatcatgaccaagacgatgacagtgatgagttgattgatgatgaa
gtccgagagatttttatcgaagaagcagatgaagttcttgaagaaatgcacagtttgctt
cctgagtggaagcaggaccagacgaataaagaagctataaacactattcgtcgtaacttc
cataccttaaaaggtagtggtcgcatggtgggtgctactgatatcggtgaattgagttgg
gcaattgaaaatatgctcaatcgcttgcttgatcacagtattgaatattcgcccgcattg
tttgtcaccactgaagaagtggcaaatatattaccgaaaatggtaaaacaatttgccggt
ggggaaagaacgcaatatccaagagatttggctgagcgagcaaatcgtatcagcaaaggt
gaaattatcaccgatatccaaccacaccaagagcaaacagaagaagaagctgatcaagca
gcagagcaagagttgtttgatatattcaagcaagaagctgagggccatgtaactaatctt
gaaatgtttgcaaatcagcgtcagcaaggtattacccagagtcagatcagcgacaacctt
ctccgctcattacataccttaaaaggtgtggcacatatagcaaatattcaatcactaact
aacgttatagttccagttgaaagctattttcaagagctgaaaactcgtgagttgttagct
gaagaaggagatatggccttaattgatcatactaaggatctgctgagatatattattagc
acaccagaagatgatcaggtgatttcagttcatgaagatgaaattcttcagcaattatca
aagcaacaaaagagatttgatgaatctggcgaaacaattcaggaacaaggccgagatccg
gagctaataaaagatattttcaatatagcttcagatgtgctggtagatattgaaagcaca
aatctacaggaaacacctgagaaagagcgtttagaaaaaatctcatatctaatggcatca
gtggatcgcctgaagagtattttgggtgaagcagagcttaatgagattgagcaagtggta
tctgcacttagtgatgcattacaacgtaatatgactgccagtaaagtagatacctcgatt
ggtgttctgctcaatgaaacctataaccaacttgaaaatcaatttgattgtctggctgct
aacttatcaattacagaagctagcgacttggtgcaggcgctacaaacctggagcccagct
gaagctactgcgggtttagaattagaattggagccggccacgggagaagctgctgctaaa
gatgagagctcatctgaagtagagtcaggacttgagtcatctgatgaaacatccgctgct
attccagcagaagaaagctctgaaccagaggaaaaacaagcgacggaagataacagtatt
gagttcagccttgatgacgacttcttgactacaaaacctgaagataagcaggaagagaaa
gatactagctttgaagaaaaagccacttctgatgataattcgatagaatttgaattctcg
gatgacttcttagcttctgagccggcggaagaagagtctagcactgaagaaattgaggac
gactcagacataagcttggaagatgcggcagaagaacttggtttagacctcagtgaggac
cttgacctatcagatgagctagattcggatgaaaccagtgaagtgacagaagaaacttca
catgaggaagtgcagcaaaaagaaactgctggagaagactcattagagtataactttgaa
gaattagacgaaacagcggaaacaacagagacgacagaagacgttgtttctaagcaagaa
gagccgcttgaagccgatgagttggcggatcaagatgaagctgccaccaccgaggaaaaa
accggagagattatagaggaagctccagaagaggagacctcacaagcagtcgaagaagag
cctagaaaagagtcagctaaaacaatcagtctcgatcttgatgtcgatgatgagttgctt
gaaatcttcagcgaagaagcagaagaactctttgatagcgatgcagctctactgcaaaaa
tggcgccaagaacctaataatgtaaaaatcattgctgaattacagcgtaacctgcatacc
ctaaaaggtagtgcaagaatggctggcttctcaccaatcggtgacttggctcatggttta
gaagatttatacaccgccattactgatcagctgtttgctgcttctgaccaagcgattgat
ctagctgagcgagctgaagatcagttgcttgctatatttaatgcaagaaatactccagac
cagattccttcacctgcagccatgctcgatgaaatccaaggatttatttcggctcagaaa
gctggcagagcctatgtaaggccacaagctgaagacattaaacctacggaaatagtagaa
gagccacaacagccagttgaagaggctaaaactgagtctccgaaagaagaaaataaagcg
gaagaaccagaacagattaagacagaagaacccacgcaagataaaggcgctttagaagag
gcagcctggaatgaagagctagcagagttattcttaggtgaagcttctgaactgctgagt
tcttatgaagaagccattgagcgatggtcaggggacttgcataatacgcaaccattaaac
tctgccatgagaaatctgcacacgctgaaaagtggtgcaaagctggcagcgattacacca
ataggtgaattaactcacaagctggaagggcttgttgaagctttagcaagagaccctcgt
ttgggcaatagtcgttgggctgatgtactacgtcgtagttatgatcaacttcatgaaatg
gttgagcaagttcgtaatggtcatatgcctgagaagccagcagagctgctgcgcaaactt
gaaagtgataaagcaacgattgaatctcagctagatcagcttgataagcgcgatctggca
gagtctggtgagcaggctgaggtcaaggttgtttcattagctgacagacagaaacagaaa
gaagaagcagctaaagaagcggcaaatcgcgatgtgattcgtgtccgctcagaggttctg
gataacttggttaacttatctggtgaggcttcgatcttccgttctcgtcttgagcagcaa
gtagccgacttaaacttcaacttgaaggaaatgtcatcgaccgttgaccgcttgcgtgag
caattacgtaatcttgagattgaaactgaagcacaggttctgtatcgccgagaaatttcc
ggggtagattttgatgagtttgaccctctcgagatggaccgttatacccgtcagcaagag
ttgactagaagccttcttgaggctgcgagtgacttaatgtcaattcaggaaacattggaa
acgaaggttggtgacgcggaagcaacgcttttggcacagggccgagtaaatacagagctt
caagatcgcttaatgcgtacgcgaatggtgccgtttaatagtattgaaagtcgtttgcgc
cgcatggtgcgtcagatttcaactgagctaaataaagatgttgatttaatactcgagtct
gaaggtgaaatggaccgtacggtaatcgagcgtatggttgcaccacttgaccatatgtta
agaaatgcaatcgaccacggtattgagtctaaaacagagcgtaagaaggcaggtaaagtt
gaaaaaggtaccgtgcacttgagcttgtcgcgtcgcggtaatgaagtttatattcaaatt
caagatgatggcgcaggtattcgtaaagataaggttcgtgcaagagcaatttctcaaggc
atgattgacgaatcttataacccaaccgatcgtgaattattccgcttaattctacaacct
ggattctccactgctgaaacagtgactcagatttctggtcgcggtgttggtatggacgtg
gttcacagtgagattttgcagttgggtggttcattaaacatcagctcagaagaaggtcaa
ggcactactatgacagtgcgcttaccattcactctgtcctctaaccaggcactgatggtg
agagttaaaggcgagccttatgcaattccattgtcgaatatcacaacggtagcacgtgtt
agtgcaaaagaagttcttgagatttaccaagataaagacaaaaccttctctcacttggga
gaagaatttgaattgcgctatttaggacaaatccttgaccgaaactcagatattattcca
ccagttgatgaatacgtaccagtactgattattcaaggtgaagacaagccgattgcggtt
catgtagatgaattgattggttcacgtgaaatcgttgttaaaaacattggtcgtcagatt
tcgacggtaccaggtatttcaggtgcttcgattcttggtgatggtagcgttgttttgatt
ctagatatgcagacgttagtagacagattccacgaatgggatttcgcacacgaagcgggt
atggtacaagaagctccagttgagaatcgcataccaatagtaatggttgtcgatgattcg
attacggttcgtaaagtaactgcaaggctactacagcgcaaccagttccaggtaatgact
gcgaaagatggtgttgatgcaattacccaattgcacgacgacattcctgatgtcatgctg
ctggatattgaaatgccaagaatggatggtttcgaattagcaactatcattcgacatgat
gagcgacttaagcatttgcctatcatcatgattacctcacgtacaggtgaaaaacaccgt
gagcgtgctgagcagataggtgtaaatcgctatttaggtaagccctataatgaggaagct
ctattaggcacaattgatgaaatgcttaagttggaagactaa

DBGET integrated database retrieval system