KEGG   Kangiella koreensis: Kkor_1639Help
Entry
Kkor_1639         CDS       T00973                                 

Definition
(GenBank) chorismate synthase
  KO
K01736  chorismate synthase [EC:4.2.3.5]
Organism
kko  Kangiella koreensis
Pathway
kko00400  Phenylalanine, tyrosine and tryptophan biosynthesis
kko01100  Metabolic pathways
kko01110  Biosynthesis of secondary metabolites
kko01130  Biosynthesis of antibiotics
kko01230  Biosynthesis of amino acids
Module
kko_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:kko00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Kkor_1639
Enzymes [BR:kko01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.5  chorismate synthase
     Kkor_1639
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Chorismate_synt
Motif
Other DBs
NCBI-ProteinID: ACV27051
UniProt: C7RCQ9
LinkDB All DBs
Position
complement(1774634..1775728)
Genome map
AA seq 364 aa AA seqDB search
MAGDSFGTLFRVTNWGESHGKAIGAVVEGCPAGLKLSEEDIQVFLDRRRPGQSSITTRRD
ESDQVQIMSGVVNGMTTGTPISLLIPNQDQRSKDYSELGSIFRPSHADYTYQKKYGIRDV
AGGGRSSARITAGHVAAGAIARKVLEQALGTEIVAYVKSVQDLTMTLDSEAVDASLIEQT
PVRCPDLKLAEQMIAKIEQARKSGDSLGGIVECRIKSVPVGLGEPVFDKLEADLAKSMLA
INASKAFEIGSGFAGTLLSGTTHNDVFINQDGEVKTRTNNSGGVLGGISNGMPIVFRVAF
KPTPTIIKEQETVNLEGEATVFHGRGRHDPCVLPRAVPIVEAMAALVLCDHYLRFRAYKD
LFNV
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atggcaggcgatagtttcggaactttattcagagtgaccaattggggtgagtctcatggc
aaagcgattggcgctgtcgttgagggctgcccagcaggtttgaaactgtctgaggaggat
atacaggttttccttgatcgccgacgtcctgggcaaagctcaattaccacccgccgcgat
gagtcggatcaggtgcagattatgtctggtgtcgttaatggcatgactaccggtacgccc
atcagcttgttaattcccaaccaggatcaacgcagtaaagactattcagagcttgggtcc
attttcaggccgagtcatgcagattacacctaccagaaaaaatacggtatacgtgatgta
gcaggtggtggccgtagctcggcgcggattaccgctgggcatgtggcagctggagccatt
gcgcgtaaagtgcttgaacaggcgcttggaaccgagattgtggcttacgtcaaaagtgta
caagatttgactatgacactcgattctgaggcggtggatgcaagcttaattgaacagaca
cctgtgcgttgccctgatttaaaactggctgagcagatgattgctaagattgagcaagct
cgcaaaagcggtgattcgctgggtggtattgttgaatgtcgaattaaatctgttcctgtg
ggattaggtgagccagtgttcgataaactggaagctgatttggcgaaatccatgctggcg
atcaatgcgtcaaaggcttttgaaattggttccggttttgctgggactttgctaagtggc
acaactcacaatgatgtctttattaatcaagatggcgaagtgaaaactcgaaccaataat
tcaggcggagtcttaggcggaatttccaatggcatgccgattgtgttcagggtggccttt
aaaccaaccccaactatcattaaagagcaagaaacggtaaaccttgaaggtgaggcaacg
gtgtttcatggcagagggcgccacgatccttgtgtgttgccacgagctgtaccgattgtt
gaagcgatggcggctttagtattgtgcgatcactatctgcgattcagagcttacaaagat
ttatttaatgtttag

DBGET integrated database retrieval system