KEGG   Kluyveromyces lactis: KLLA0D12496gHelp
Entry
KLLA0D12496g      CDS       T01025                                 

Definition
(RefSeq) hypothetical protein
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
kla  Kluyveromyces lactis
Pathway
kla03030  DNA replication
kla03410  Base excision repair
kla03420  Nucleotide excision repair
kla03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:kla00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    KLLA0D12496g
   03410 Base excision repair
    KLLA0D12496g
   03420 Nucleotide excision repair
    KLLA0D12496g
   03430 Mismatch repair
    KLLA0D12496g
Enzymes [BR:kla01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     KLLA0D12496g
    6.5.1.6  DNA ligase (ATP or NAD+)
     KLLA0D12496g
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     KLLA0D12496g
DNA replication proteins [BR:kla03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    KLLA0D12496g
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     KLLA0D12496g
DNA repair and recombination proteins [BR:kla03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     KLLA0D12496g
   NER (nucleotide excision repair)
    Other NER factors
     KLLA0D12496g
   MMR (mismatch exicision repair)
    Other MMR factors
     KLLA0D12496g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C
Motif
Other DBs
NCBI-GeneID: 2892839
NCBI-ProteinID: XP_453619
UniProt: Q6CR20
LinkDB All DBs
Position
D:complement(1059684..1061786)
Genome map
AA seq 700 aa AA seqDB search
MFRLPIIRNWIVQRPVTFKVPSQQMSTKRSKQLTLDGFLRPNKKQKVDEEGDSAMPDETA
AAPPVKSESSLSNITPPKSRGETLTPVPSKLKFHSNIPFAELCDTFQAIEVTSSRLAITA
ICSKFLYSVLERDPESLVPITYLFIHKLGPDYEPGLELGLGESLLIKTISEACGKSIQQI
RNKYREIGDLGEIAMQARNVQPTMFKPKPLTVGEVFNNLVSIAKSNGKDSQSRKGSLIKK
MLTACKGYEAKFLIRSLESKLRIGLAEKTVLISVSKAILTHEHNGQEPSTEMVEQAESLI
RDAFCQVPNYEMIINVALQYGIMNLNQHIKLRPGIPLQPMLAKPTKSISEVLDRFQGTKF
TCEYKYDGERAQVHLCRDGSMKIYSRNGEDMTERYPEIDVKHYVKDLGATKSFIVDSEAV
AWDQEQGKILPFQVLSTRKRKGVELKDVKVRVCLYAFDILCLNDEPLINKSFHERRQILL
DTFNGTQGQFDFANELTTTNFDELQKYLDQSVKDSCEGLMVKMLEGEESHYEPSKRSRNW
LKLKKDYLEGVGDSLDLVVLGAYYGRGKRTGTYGGFLLGCYNLDSEEFETCCKIGTGFSD
EMLQDLYTKLKDTTVEHPSTNVIYDSSAPADVWFEPSMLFEVLTADLSLSPVYKAGFEAF
GKGISLRFPRFVRIRDDKNVTDATSSDQVIEFYESQAHMK
NT seq 2103 nt NT seq  +upstreamnt  +downstreamnt
atgtttcgacttccgataattagaaattggatagttcagagaccagttacgtttaaagta
ccatcgcagcaaatgtcgacgaaacgtagtaagcaattgactttagatgggtttttgcga
ccaaataagaaacaaaaggtcgatgaggaaggtgattcagccatgcctgatgaaactgcg
gcggctcctccagtgaagtcggaatcatcgttatctaatatcactccgccaaagagtaga
ggagaaactcttactcctgttcctagcaagcttaaattccattccaatatcccatttgct
gagctatgtgatactttccaggccattgaagttacctcatctagactagcaatcactgct
atctgttccaaatttctatattctgtattagaaagggatcctgaatcattagttccgatt
acttaccttttcatccataaattagggcccgattatgaaccgggactcgaattagggttg
ggtgaatcgttattgatcaagaccatcagtgaggcatgtgggaagtcgatacaacagatc
agaaacaagtaccgtgagattggtgatttgggagaaatcgcgatgcaagcaagaaacgta
caacctacaatgtttaaaccaaaacccttaacagtgggggaagtattcaacaatttggta
tcgattgctaaatcgaacggtaaggactctcaatctaggaaagggtcgttgatcaagaag
atgttaactgcgtgcaaaggttacgaggccaaattcttgatcaggtcactcgaatccaag
cttagaatcggattggcagagaaaactgtcttgatatcagtcagtaaggcaattctaacc
catgagcataacgggcaagagccgagcacggagatggtcgaacaagcagagtcattgatc
cgtgatgcattctgtcaagttcccaactacgaaatgatcatcaatgttgcgttacagtac
ggaatcatgaatttgaaccaacatatcaaattgaggccggggattcccttacaaccgatg
cttgcgaaacccacaaaatcaatcagcgaggtgttggacaggttccagggcactaagttt
acctgtgagtacaaatatgacggtgaaagagcacaagtgcatttgtgtagggatggatct
atgaagatttattcacgtaacggagaagacatgacagaaaggtaccccgagatcgatgta
aagcattatgttaaagatttgggcgccacgaaatcgttcattgtagatagcgaagcggtc
gcgtgggatcaagaacagggcaagattcttccattccaagtactaagtacaaggaagcgt
aagggagtagaattgaaagacgtgaaggtacgtgtatgtctttatgctttcgatatacta
tgtctaaacgacgaacccttgattaacaagtcgttccatgaaagacgtcagatattacta
gacacgttcaacggaacccaaggtcaattcgattttgcgaacgaactaacaaccactaat
ttcgatgaactacagaagtatctagaccaatccgtgaaagactcatgcgagggcctcatg
gtcaagatgttagaaggagaggagtcccattacgaacccagtaagagatcgagaaactgg
ttaaaattgaagaaggattacttggaaggtgtcggggactccctagacctagtggtcctt
ggagcctactatggacgcgggaaaagaacaggcacctacggtggattcctcttgggctgc
tacaacttggattcagaggaattcgaaacatgttgcaagataggaacaggcttcagcgat
gagatgttacaagatttgtataccaaattgaaggacaccacagtagaacacccgagcaca
aacgtgatatacgattcatctgccccagcagatgtatggtttgaacccagcatgttgttc
gaggtcctgactgcggatctctcgctttcaccggtgtacaaagccggttttgaagccttc
ggtaagggaatatcgctacgctttcccaggttcgtaagaataagagacgataaaaatgtc
actgacgcaacctcatccgatcaagtgatagagttttacgagtcacaggcccatatgaaa
tag

DBGET integrated database retrieval system