KEGG   Kluyveromyces lactis: KLLA0E01981gHelp
Entry
KLLA0E01981g      CDS       T01025                                 

Definition
(RefSeq) hypothetical protein
  KO
K06067  histone deacetylase 1/2 [EC:3.5.1.98]
Organism
kla  Kluyveromyces lactis
Pathway
kla04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:kla00001]
 Organismal Systems
  Aging
   04213 Longevity regulating pathway - multiple species
    KLLA0E01981g
Enzymes [BR:kla01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     KLLA0E01981g
Chromosome and associated proteins [BR:kla03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     KLLA0E01981g
   HDAC complexes
    Sin3A-HDAC complex
     KLLA0E01981g
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    KLLA0E01981g
  Chromatin remodeling factors
   NuRD complex
    KLLA0E01981g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 2894684
NCBI-ProteinID: XP_454037
UniProt: Q6CPV2
LinkDB All DBs
Position
E:complement(186177..187475)
Genome map
AA seq 432 aa AA seqDB search
MVYEAKPFDPITVKANEKKRVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLIMNYGLYKK
MEIYRAKPATKQEMCQFHTDEYIDFLSRVTPDNLDMFQKESVKFNVGDDCPVFDGLYEYC
SISGGGSMEGAARLNRGKCDVAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHPRV
LYIDIDVHHGDGVEEAFYTTDRVMTCSFHKYGEFFPGTGELRDTGVGKGKYYAVNVPLRD
GIDDATYKSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMKGHANCVNYMKS
FGVPLMIVGGGGYTMRNVARTWAFETGILNNVILDEELPYNDYYEYYGPDYKLDVRPSNM
YNVNTPEYLDKVLLNIFSNLEHTKYAPSVQLNHVPRDAEDKGDAEEDTAAAKDTRGGSQY
ARDITIENATEF
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atggtatacgaagctaaaccttttgacccgataacggtgaaggctaacgagaagaagcga
gttgcatacttttatgatgctgatgtgggaaactatgcttatggtgcaggacatcctatg
aaaccacatagaataagaatgacacattcgttgattatgaattacggtttgtataagaag
atggaaatttacagggctaaacctgcaacgaaacaggagatgtgtcagttccataccgat
gaatatattgatttcttgtctcgagtcactccagataatttagatatgttccaaaaggag
agtgtgaaattcaacgttggagacgattgtcctgtgtttgatggtttgtacgagtactgt
agtatatctggaggtggttctatggagggtgcagccagattaaaccgaggcaaatgtgat
gttgccattaactatgctggtggtttacatcatgccaaaaaatcggaagcttcagggttc
tgttacttgaacgatatagtgctaggtatcatcgagttgttaaggtaccatcctcgtgtt
ctttatattgatattgatgtgcatcacggtgatggtgtagaagaagctttttatactacg
gatcgagttatgacatgttctttccataaatatggggaattcttcccaggtactggtgaa
ttgagagatactggtgtcgggaaaggtaaatactatgctgtgaatgtcccattaagggac
ggtattgacgatgccacttacaaatcggtatttgaaccagtcataggtaaaattatggaa
tggtaccaaccttctgccgtggtactccaatgcggtggtgactctttatccggcgatcgt
ttaggttgtttcaacctttcaatgaagggtcacgcaaactgtgtcaactacatgaaatcg
ttcggtgttcctctcatgattgttggtggtggtggttatacaatgcgaaacgtggctcgt
acatgggctttcgaaacgggtattctgaataatgtgattttggatgaagaacttccttac
aacgattactacgaatattatggccctgattacaaattggatgtcagaccatctaatatg
tataacgtcaatacaccggagtatttggataaagtgctacttaatattttcagcaatcta
gagcatactaaatatgccccaagcgttcaactcaatcacgttcctcgcgatgcggaggac
aaaggtgacgccgaagaagatactgcagctgcgaaggacactagaggaggttctcagtat
gcaagagacataaccattgagaatgcaaccgaattttag

DBGET integrated database retrieval system