KEGG   Kluyveromyces lactis: KLLA0E05567gHelp
Entry
KLLA0E05567g      CDS       T01025                                 

Definition
(RefSeq) hypothetical protein
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
kla  Kluyveromyces lactis
Pathway
kla04146  Peroxisome
kla04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:kla00001]
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    KLLA0E05567g
 Organismal Systems
  Aging
   04213 Longevity regulating pathway - multiple species
    KLLA0E05567g
Enzymes [BR:kla01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     KLLA0E05567g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 2893843
NCBI-ProteinID: XP_454197
UniProt: Q6CPE2
LinkDB All DBs
Position
E:complement(498639..499106)
Genome map
AA seq 155 aa AA seqDB search
MVNAVAVLKGDSSVSGIVRFEQESEDQQTKISWEITGNDANALRGFHIHTFGDNTNGCTS
AGPHFNPFNKNHGAPEDEERHVGDLGNIPTDAQGISKGSLTDKHIKLLGPLSIVGRTVVV
HAGQDDLGKGGDAESLKTGNAGARHACGVIGISNA
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atggttaatgcagttgcagttttgaagggtgattcctctgtttcaggtattgttagattc
gaacaagaatcagaagatcaacaaaccaagatttcttgggaaatcactggtaatgacgcc
aatgctttgagaggtttccatatccatacttttggtgacaacaccaatggttgcacctct
gctggtccacatttcaacccattcaacaagaaccacggtgctccagaagatgaagaaaga
cacgtcggtgacttgggtaacattccaactgatgctcaaggtatttctaagggtagtttg
actgacaagcacattaagttactgggtcctctatctatcgtcggcagaaccgttgttgtt
cacgctggtcaagatgatttaggtaagggtggcgatgctgaatctttgaagaccggtaac
gccggtgccagacacgcctgtggtgttattggtatctctaacgcttaa

DBGET integrated database retrieval system