KEGG   Kluyveromyces lactis: KLLA0_B04609gHelp
Entry
KLLA0_B04609g     CDS       T01025                                 

Definition
(RefSeq) uncharacterized protein
  KO
K20300  trafficking protein particle complex subunit 1
Organism
kla  Kluyveromyces lactis
Brite
KEGG Orthology (KO) [BR:kla00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:kla04131]
    KLLA0_B04609g
Membrane trafficking [BR:kla04131]
 Endosome - Golgi transport
  Tethering complex
   TRAPP complex II
    KLLA0_B04609g
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   TRAPP complex I
    KLLA0_B04609g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sybindin DUF5055 Spa1_C HTH_44
Motif
Other DBs
NCBI-GeneID: 2897164
NCBI-ProteinID: XP_451738
UniProt: Q6CWF1
LinkDB All DBs
Position
B:join(412600..412633,412731..413134)
Genome map
AA seq 145 aa AA seqDB search
MIYSLWIFDRHCNCIFDKEYTVNQSTSIVNSKEQQSRGKLIYGMVHSLKAMSTKIAPGNT
LRTLTTGKYRIHALFTASNLWIVIFSDLTHHELHERLDKIYELYLKYVVHNMLKPIDLRE
SENAKESDKITSPSFIKAVDQVLCL
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atgatatactcactttggatctttgacaggcattgcaactgcatattcgataaagagtat
acagtaaatcagtcaacatccattgtaaactctaaagaacaacaatccagaggaaaactc
atatatggtatggtgcactcattaaaagcgatgtccacaaagatagcaccaggtaacaca
cttcgaacactaacaaccggaaaatatagaatacacgcactattcacggcatctaaccta
tggattgttatcttttctgatttgacgcaccatgaattgcacgaaagattggataaaatt
tatgaattatacttaaaatatgtggtacacaatatgctaaaaccgattgatttgagagaa
tctgagaatgctaaggaaagcgataagattacgagcccttcgtttataaaggctgtagat
caagtgctatgtttatag

DBGET integrated database retrieval system