KEGG   Kluyveromyces lactis: KLLA0_C14432gHelp
Entry
KLLA0_C14432g     CDS       T01025                                 

Definition
(RefSeq) uncharacterized protein
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
kla  Kluyveromyces lactis
Pathway
kla00250  Alanine, aspartate and glutamate metabolism
kla00410  beta-Alanine metabolism
kla00430  Taurine and hypotaurine metabolism
kla00650  Butanoate metabolism
kla01100  Metabolic pathways
kla01110  Biosynthesis of secondary metabolites
Module
kla_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:kla00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    KLLA0_C14432g
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    KLLA0_C14432g
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    KLLA0_C14432g
   00430 Taurine and hypotaurine metabolism
    KLLA0_C14432g
Enzymes [BR:kla01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     KLLA0_C14432g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC OKR_DC_1 DUF4362 Noelin-1
Motif
Other DBs
NCBI-GeneID: 2892276
NCBI-ProteinID: XP_452846
UniProt: Q6CT93
LinkDB All DBs
Position
C:1256193..1257896
Genome map
AA seq 567 aa AA seqDB search
MLHKEKDIEESKRFFHHSTSGMEGNPDGFGLLPDGSKLESVKDTRIDKFAVPKKGLHSEH
VYNLVKNELKLDGNPVLNLASFVNTFTDQFAQKLIDENLNKNLADNDEYPQLIHMNERCI
SMLAKLWQSDTDRDTPLGCATTGSSEAIMLGGLAMKRQWEKKMRAANKSTEKPNIIMSSA
CQVALEKFARYFDVECRLVPVDTEHGYHLNPNKLWDYVNENTIGIFVILGTTYTGHLENI
EQVAEVLEHIEAQHPDWSNKDIPIHVDGASGGFIVPFAFTEAQMESYGLGRWGFNHPRVV
SINTSGHKFGLTTPGLGWIVWKNDEYLLPELRFKLKYLGGIEETFNLNFSRPGFQVIHQY
YNLLTLGQQGYYEKFNQSIFVARAFAWKLLQDPDMRDVFEVVSCLHENLDNSSIAESLDD
YWKNPHDYKPGIPLCAFKLSEKFKSEHPEIPQSIISTLLRQKGWIIPNYPLPESTDGSDK
KEVLRVVFRIEMKLDMALLLVQDVFEVVQKLLKSYEYLNIRTENDNHAVFKVLSTLSNAD
VSELEHELTDSQKEKEQHIKKNYRGTC
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atgttgcacaaggaaaaggatatcgaagaatccaagagattctttcatcacagtacatct
ggaatggaaggtaaccctgatgggttcggcctattgccagatggttccaaactggaaagc
gttaaagataccaggattgataaattcgctgttccaaagaaagggttacatagcgaacat
gtttataacttggtgaagaacgagttgaaactagatggtaatccagtcttaaacttggca
agtttcgtgaacactttcactgaccagtttgctcagaaattaatcgatgagaacttgaat
aaaaatctagcagacaacgatgagtatcctcaattaatccatatgaatgaaagatgtatc
tcaatgttggcaaagctctggcaatcagatactgatcgagacactccattgggttgtgcc
accactggttccagtgaagctattatgttaggtggtcttgctatgaagagacaatgggaa
aagaaaatgagggctgccaataagtccactgaaaaacctaacattattatgtcaagtgca
tgtcaagtcgcattggaaaaattcgctcgttactttgatgttgaatgtaggctagtacca
gtcgacaccgaacatggctatcatttgaatcctaacaaactctgggattatgttaatgaa
aacaccattggtatctttgtaatcttgggtaccacatacactggacacttggaaaatatt
gaacaagttgcagaagttcttgaacatattgaagctcaacacccagattggagcaacaag
gatatcccaattcacgtggatggtgcctcgggtggctttattgttccctttgctttcaca
gaagctcaaatggagtcgtatgggctaggtcgttggggttttaaccatccaagggttgta
tccattaacacttctggtcataaatttggattgactacccctggtttaggatggattgtt
tggaaaaacgatgagtacttactacctgagctcagattcaaattgaagtacctaggtggt
atcgaagaaacattcaacttgaacttctccagacccggtttccaagttattcatcaatat
tataacttattgacattaggtcaacaaggatattacgaaaagttcaatcagtcgatcttt
gttgcgcgtgcgtttgcatggaagttgttacaagaccctgacatgagagatgtttttgaa
gttgtcagttgtttacatgaaaatttagacaacagctccattgcagaatccttggacgat
tactggaagaatccacacgactacaaaccaggtatccccttatgtgctttcaaattgtct
gaaaaattcaaatctgaacacccagagataccccaatcaatcatttcgacgttgttaaga
caaaaaggatggatcattcctaattatccattacctgagtctactgatggtagcgacaaa
aaagaagtattaagagtggtcttcagaattgaaatgaagttggatatggcattgctattg
gtgcaagacgtattcgaggttgtccaaaaattgctgaagtcgtatgaatacttgaatata
cgtaccgaaaatgataatcatgcggttttcaaagtattaagcactctgtctaatgctgac
gtcagtgagttggaacatgaacttaccgactcacaaaaagaaaaagagcagcacatcaag
aaaaattacagaggtacttgttaa

DBGET integrated database retrieval system