KEGG   Kluyveromyces lactis: KLLA0_D00231gHelp
Entry
KLLA0_D00231g     CDS       T01025                                 

Definition
(RefSeq) uncharacterized protein
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
kla  Kluyveromyces lactis
Pathway
kla00052  Galactose metabolism
kla00500  Starch and sucrose metabolism
kla01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kla00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    KLLA0_D00231g
   00500 Starch and sucrose metabolism
    KLLA0_D00231g
Enzymes [BR:kla01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     KLLA0_D00231g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C hDGE_amylase Alpha-amylase_C
Motif
Other DBs
NCBI-GeneID: 2893072
NCBI-ProteinID: XP_453081
UniProt: Q6CSK8
LinkDB All DBs
Position
D:complement(9854..11626)
Genome map
AA seq 590 aa AA seqDB search
MTITKFVSEHPQTDPKWWKEAIVYQVYPASFKDSNHDGWGDIKGIDSKLEYIKELGANAI
WICPFYDSPQEDMGYDISDYEKVWPRYGTNEDIFNLIDRAHGLGIKIIVDLVINHCSSEH
AWFKEARSSLDNPKRDWFIWKAPKGFDSNGKPIPPNNWRSFFGGSAWEYDEHTGQFYLRL
FAKGQPDFNWENEVTRNAIYESAVGFWLDHGVDGFRIDTAGLYSKQPGFPDVPIINPGLD
FQHPDPAILNGPRIHEFHKEMNKFMRERVKDGRELLTVGEIPCGTHDVCKAYTSAKEQEI
TQLFEFEHVSVGRKPGNVGVVNFKLSEFKDGIAAAFQFIDKTDSWSTVYIENHDQPRSVT
RFGDDSPEYREISAKLLALLETSLTGTLYVYQGQELGMINFRDWPIEKYEDVEVKGMYKM
MVDQFGADSDQVKDYVNGLQLISRDHARTPFPWTSEAPYAGFTDGKEPWFPLTETFQEGI
NAEDELKDPKSVFNFWKTAIEVRKTHKDVLNYGYDFTFVDHANEKLFAFTKKYGEKVLYV
VLNFSKEEIEFSFLEGYNSYDYIFGNYPEAEIDTGSNKLQPWEGRFYYAN
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atgacgattaccaagtttgtatccgagcacccccaaacagacccaaagtggtggaaagaa
gcaattgtttaccaggtttaccctgctagtttcaaagactctaaccatgatggatggggt
gatatcaaaggtattgattcgaagctggagtacattaaagaacttggagctaacgcgatt
tggatctgcccattctatgattctccacaagaggatatgggttatgatatttcagattac
gaaaaggtttggccacgctacggtacgaatgaagatatcttcaatttgatcgacagagca
cacggtttgggaatcaaaatcattgtggatcttgttatcaatcactgctcttctgaacac
gcttggttcaaagaagctcggtcgagcttggataaccccaaacgtgattggtttatctgg
aaagcaccaaagggattcgactccaatggcaaaccaattcctcccaataactggagatct
ttctttggtggttctgcctgggagtacgatgaacataccggccaattctacctgcgttta
tttgcgaaaggtcaaccagatttcaattgggagaatgaagtgactcgtaatgccatttac
gaaagtgctgtaggattctggttagaccatggtgtcgatggtttcagaatcgatacagct
ggtctatactccaagcaaccagggttccctgatgtgccaataatcaaccctggtttggac
ttccagcatcctgacccagctattttgaatggtccaaggattcatgaattccacaaggag
atgaacaaatttatgagagagcgtgttaaagatggcagagagttgttaacggtgggtgag
attccttgtgggactcatgacgtgtgcaaggcgtacaccagtgcaaaagagcaagaaatt
actcaactattcgaatttgagcacgtgtctgtgggtaggaagccgggaaatgttggtgta
gttaactttaaactgtcagaattcaaggatggtattgcggcagcattccagttcattgat
aagacagactcttggtccactgtctacattgaaaaccatgaccagccacgttctgtgaca
agattcggggatgacagcccagagtaccgagaaatatcagcaaaattgctggctctgttg
gaaacaagtttgacaggcactctgtacgtataccaaggccaggaattaggtatgattaac
ttcagagactggccaattgagaaatatgaagatgtcgaagtgaaaggtatgtacaagatg
atggttgatcaattcggtgcggactctgatcaagtcaaagattacgttaatggtttgcag
ttgatttctagagaccatgcgaggactccattcccatggacatccgaggctccatatgct
ggattcacagacggcaaggaaccatggttccctttaactgagactttccaagaaggtatc
aacgccgaagatgagctgaaagacccaaagtctgttttcaatttttggaagacggctatt
gaagtcagaaagacacacaaggatgtattgaattatggatatgacttcacctttgttgac
catgctaacgagaaactctttgctttcactaagaagtacggagagaaggtattgtatgtg
gtgttgaacttcagcaaagaagagattgagttcagcttcttggaaggttacaactcttat
gactacattttcggtaattatccagaggccgaaatcgacactggatctaacaagttacag
ccatgggaaggtagattttactatgccaattga

DBGET integrated database retrieval system