KEGG   Kluyveromyces lactis: KLLA0_D04444gHelp
Entry
KLLA0_D04444g     CDS       T01025                                 

Definition
(RefSeq) uncharacterized protein
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
kla  Kluyveromyces lactis
Pathway
kla00020  Citrate cycle (TCA cycle)
kla00190  Oxidative phosphorylation
kla01100  Metabolic pathways
kla01110  Biosynthesis of secondary metabolites
kla01130  Biosynthesis of antibiotics
kla01200  Carbon metabolism
Module
kla_M00009  Citrate cycle (TCA cycle, Krebs cycle)
kla_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
kla_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:kla00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    KLLA0_D04444g
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    KLLA0_D04444g
Enzymes [BR:kla01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     KLLA0_D04444g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C GIDA Pyr_redox_2 Thi4 FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 2892714
NCBI-ProteinID: XP_453260
UniProt: F2Z614 Q7Z864
LinkDB All DBs
Position
D:377424..379379
Genome map
AA seq 651 aa AA seqDB search
MLRTVRGRRVGLAQANFKSLVQARKFSSQMVLRQTISANGDINGQQQEAGSSSSHGYNII
DHEYDCVVVGAGGAGLRAAFGLAEAGYKTACISKLFPTRSHTVAAQGGINAALGNMHKDD
WKWHMYDTVKGSDWLGDQDSIHYMTREAPKSIIELEHFGVPFSRTEEGRIYQRAFGGQSK
EYGKGGQAYRTCAVADRTGHALLHTLYGQALRHNTHFFIEFFAMDLLTHNGEVVGVMAYN
QEDGTIHRFRAHKTIIATGGYGRAYFSCTSAHTCTGDGYAMVSRAGFPLQDLEFIQFHPS
GIYGSGCLITEGARGEGGFLVNSEGERFMERYAPTAKDLACRDVVSRAITMEIREGRGVG
PEKDHMFLQLNHLPPSVLHERLPGISETAAIFAGVDVTKEPIPILPTVHYNMGGIPTKWN
GEALTIDEETGEDVLIPGLLACGEAACVSVHGANRLGANSLLDLVVFGRAVAHTIADTLQ
PGLPHKPLPADLGKESIANLDKLRNATGHRPTADIRLAMQKTMQKDVSVFRTQASLDEGV
KNINAVDKTFVDVGTTDRSMIWNSDLVETLELQNLLTCATQTAKSAAERKESRGAHARED
YPERDDVHWMKHTLSWQRDTGDDVVLKYRKVIATTLDEKECPPVPPTVRAY
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
atgcttagaacagtaagaggaaggagagttggccttgctcaggccaatttcaaatcattg
gtgcaagccagaaagtttagctctcaaatggttttgagacaaacgatttcggccaatggt
gacatcaatggacagcagcaagaggctgggtcatcttccagccatggatataacatcatc
gatcatgaatacgactgtgtcgttgttggtgctggtggtgctggtttacgtgctgctttt
ggtcttgcagaggctggatacaaaactgcatgtatttctaagttgttccctactagatct
cataccgttgctgcgcaaggtgggatcaacgctgcgttgggtaacatgcataaagatgat
tggaaatggcatatgtacgataccgtgaagggttcggattggttaggtgaccaagattcg
attcattacatgactcgtgaggctccaaaatctattatcgaattggaacatttcggtgta
ccattctcaagaaccgaagagggtagaatttaccaaagagcctttggtggtcaatccaaa
gaatatggtaaaggtggtcaagcttacagaacttgtgccgtcgctgatcgtaccggtcac
gctttactacatactttgtatggtcaagctttaagacacaacacccatttctttattgaa
ttcttcgctatggatcttttgacccataacggtgaagtcgttggtgttatggcttacaac
caagaagacggtaccatccacagattccgtgctcacaagaccattatcgctactggtggg
tacggtcgtgcctacttctcttgtacatctgctcatacttgtacaggtgatggttatgct
atggtttctcgtgctggtttcccattgcaagatttggaatttattcaattccatccttcc
ggtatctacggttccggttgtttgatcactgaaggtgctcgtggtgagggtggtttcttg
gttaactctgaaggtgaacgtttcatggaacgttatgctccaactgctaaggatttagct
tgtagagacgttgtttctcgtgccatcaccatggaaatcagagaaggtagaggtgttggt
ccagaaaaggatcacatgttcttgcaattgaaccatttgccaccttctgtgcttcatgaa
cgtttgccaggtatctctgaaactgcagccattttcgccggtgtcgatgtcactaaggaa
ccaattcctatcttacctactgtccattataacatgggtggtattccaactaagtggaac
ggtgaagctttgactatcgatgaagaaaccggtgaagatgttctcatcccaggtctactt
gcctgtggtgaagcagcttgtgtctctgttcacggtgctaacagattgggtgctaattcc
ttgttagatttggtcgtgttcggtcgtgctgtcgctcatactatcgctgacactttgcaa
ccaggtttacctcataagccattgccagctgatttgggtaaggaatctatcgctaacttg
gacaagttgagaaatgctaccggtcacagaccaaccgctgatatcagattggccatgcaa
aagaccatgcaaaaggatgtttctgtgttcagaactcaagcatccctagatgaaggtgtc
aagaacattaacgctgttgataagactttcgtcgatgttggaacaacagacagatccatg
atctggaactccgatttagtcgaaactctagagctacaaaacttgttgacctgtgctact
caaaccgctaagtctgctgctgaaagaaaggaatctcgtggtgctcacgctagagaagat
tatcctgaaagagatgacgttcactggatgaaacataccctatcatggcaacgtgatacc
ggtgacgatgtcgtcttgaaatacagaaaggtcatcgccaccaccttggatgaaaaggaa
tgtcctccagtcccaccaactgttagagcttattaa

DBGET integrated database retrieval system