KEGG   Kluyveromyces lactis: KLLA0_E04093gHelp
Entry
KLLA0_E04093g     CDS       T01025                                 

Definition
(RefSeq) uncharacterized protein
  KO
K13341  peroxin-7
Organism
kla  Kluyveromyces lactis
Pathway
kla04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:kla00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    KLLA0_E04093g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: WD40
Motif
Other DBs
NCBI-GeneID: 2893852
NCBI-ProteinID: XP_454128
UniProt: Q6CPL1
LinkDB All DBs
Position
E:371642..372760
Genome map
AA seq 372 aa AA seqDB search
MLKYHMKGYSGYGVAYSPFYDNKLAVASGSNFGLVGNGKLIILDIMPNGQLVESNSFLTQ
DGLFDLAWNESHENQCLVAQGDGSLRLFDIKLKDYPIAIYKEHQREVFSCNWNMIQKQMF
VSSSWDGKVKLWSLMRPQSLMTMSPNDTNAASTLSRTSAVAPVRVPMSNQKEHQHADGNK
ECIYQATFSPHDPNLVLCSSGNSFISLYDLRVPNNGLPQHQFLGHGGFEALTCDFNKYRP
HIIATGGVDKMIKVWDLRMCRKMLSQGHQPININEIQGHELAVRKVTWSPHHSNMLLSTS
YDMTCRVWTDLSDDGHGLTGKTNSIDPAHGCRFIFMEHSEFVFGADWSLWGTPGFVASTG
WDGQVCIWNGIR
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgttaaagtatcatatgaaaggctatagtggttacggtgtagcttactcacctttctac
gataacaaacttgcggttgcttcaggttctaactttggtttggttggtaatggaaaacta
ataattttagacataatgccaaatggtcagttagtagagtctaattctttcctaactcaa
gatgggcttttcgacttggcatggaatgaatctcatgagaaccagtgccttgttgctcaa
ggcgatggttctttgaggttattcgatattaaattgaaggactatccaatagccatatat
aaggaacaccaacgtgaagtattcagctgcaattggaatatgatacaaaagcagatgttt
gtcagcagttcttgggatggaaaagtgaagctatggtctttgatgagacctcaaagtttg
atgactatgagtccgaacgacactaatgctgcttcaactctcagtagaacctccgctgtt
gcgccggtacgtgtaccaatgtccaatcagaaagagcaccagcacgctgatggaaacaaa
gaatgtatctaccaggctaccttttctccgcatgatccaaacctagtcttatgttcttct
ggaaattcattcatttcgctttacgatctaagggtgcctaataatgggttaccgcaacat
caatttcttggccatgggggatttgaagccttgacctgtgattttaacaaatatagacct
catataattgctacgggtggagtggataagatgataaaagtatgggatttgagaatgtgc
agaaaaatgctgtcacaaggacatcaaccaatcaacattaatgaaattcaaggccatgaa
ttagccgttagaaaagtgacatggtcacctcatcatagtaacatgttactttcaacatca
tatgatatgacgtgcagagtttggacagatctaagtgatgatggtcatgggctgaccggg
aaaacgaatagcattgatccagcccatggttgtagattcatatttatggagcattccgag
ttcgtttttggagcagattggagtttatggggtacgccaggctttgttgcttcgactggc
tgggatggtcaagtttgcatttggaatggcataagatag

DBGET integrated database retrieval system