KEGG   Kluyveromyces lactis: KLLA0_E08053gHelp
Entry
KLLA0_E08053g     CDS       T01025                                 

Definition
(RefSeq) uncharacterized protein
  KO
K13800  UMP-CMP kinase [EC:2.7.4.14]
Organism
kla  Kluyveromyces lactis
Pathway
kla00240  Pyrimidine metabolism
kla01100  Metabolic pathways
Module
kla_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:kla00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    KLLA0_E08053g
Enzymes [BR:kla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.14  UMP/CMP kinase
     KLLA0_E08053g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADK AAA_17 AAA_18 Thymidylate_kin AAA_33 SRP54 Zeta_toxin Linker_histone
Motif
Other DBs
NCBI-GeneID: 2893662
NCBI-ProteinID: XP_454313
UniProt: Q6CP26
LinkDB All DBs
Position
E:complement(724562..725470)
Genome map
AA seq 302 aa AA seqDB search
MLRSFIPTSRSVLLRYSPVQNYVLRSSVCRGLINAGQIQSYSQKASATATSASDSKGGNN
GGKGKLLLILGLLALGSSVVSLSYQKNPPVAFEEGPVSDDKKKTPAFSKDDVLVVFVLGG
PGAGKGTQCAKLVKDFGFVHLSAGDLLRAEQAREGSQYGELIKKCIKDGEIVPQEVTVAL
LKNAITSNYNSSNKKFLVDGFPRKMDQAITFEEEIVPSTMTLFFDCPEKIMLERLLQRGK
TSGRIDDNIESIQKRFKTFVETSVPVVEYFEKQNKVVKVSCNQPVDEVYQHVTEAIKDKI
SK
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgttacgttcctttattcctacttcaagatctgtactattgagatattctccagttcaa
aattatgttttgagatcttccgtatgcagagggctaatcaatgccggtcaaatccaatca
tactctcaaaaggcttctgccactgctacgagtgcatccgatagcaaaggcggtaacaat
ggtggtaagggtaaactacttctcattttaggtctattggcattgggttctagtgttgtt
tcgttaagttatcaaaagaacccaccggtagcatttgaagagggaccagtttctgatgat
aagaagaagacacctgccttcagcaaggacgatgtattggttgtctttgtgcttggtggt
cctggtgccggtaaaggtactcaatgtgccaaattggtaaaagatttcggattcgtccac
ttatcagcaggtgatctcttacgtgccgagcaagctcgtgaaggttctcaatacggtgaa
ttgatcaaaaaatgcataaaagatggtgaaatcgtaccacaagaagtcactgtagctcta
ttgaaaaatgctatcacttctaattacaactctagtaacaagaaattcttggttgatgga
ttcccaagaaagatggatcaagccatcactttcgaagaagaaattgttccaagtactatg
actttattcttcgattgtccagagaaaatcatgcttgaaagacttctacaaagagggaaa
actagtggaagaatcgatgataacatcgaatccattcaaaagagattcaaaaccttcgtc
gaaacaagtgttcctgtcgttgaatatttcgaaaagcaaaataaagttgtcaaagttagc
tgtaaccaacctgttgacgaagtttatcaacatgtcactgaagctatcaaagacaaaatt
tccaaatga

DBGET integrated database retrieval system