KEGG   Kluyveromyces lactis: KLLA0_F00858gHelp
Entry
KLLA0_F00858g     CDS       T01025                                 

Definition
(RefSeq) uncharacterized protein
  KO
K11484  histone deacetylase HOS3 [EC:3.5.1.98]
Organism
kla  Kluyveromyces lactis
Brite
KEGG Orthology (KO) [BR:kla00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:kla03036]
    KLLA0_F00858g
Enzymes [BR:kla01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     KLLA0_F00858g
Chromosome and associated proteins [BR:kla03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     KLLA0_F00858g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 2895833
NCBI-ProteinID: XP_455118
UniProt: Q6CLS1
LinkDB All DBs
Position
F:complement(78519..80666)
Genome map
AA seq 715 aa AA seqDB search
MSQDPLHNFKVQFEKFVASNPNVSSVTSSASRIPESSKAVIVLSPYSLSHQFPRYWVSKS
YKKTIVERPERLLACCIGVSAAITMYPALFSVKTSNHHKTSLLAPHVLKVHGKDWPRELL
KLCKESEKKIDNEEVEVPPDWNVGDIYLSKHTIAALEGSIGALEIGVDSIFQGVSVEQTA
NRAFIAIRPPGHHSHASTPSGFCLLNNAHIAIEYAFEKYDVTHAVILDFDLHHGDGTQDI
CWKRAGFRPDEFSTDAEHGASEDDNKYDEFGKSFAEFPKVGYFSLHDINSFPTELGYATK
ENIRNASTCIMDAHDINIWNVHLQSYKDEEEFVKLYQTKYRSIFAKADEFFKNAKLEMKQ
GGFRFKGLVVISAGFDASEYEQQSMQRHNVNVPTSFYNLFTKDALKLAQMHSNGKIISVM
EGGYSDGAIASGVFSHLIGFQNQNWISEWGSEQVVKEIIRGCKPRWKPYKTKKARDVIRI
WAEEVIMLGRSMIPEFEKVLFDTEDTVTHPEVRLTRSKYHETIVKHENEIPRTETPTPVR
REKPSEQPKDENVPFVDQILPSDEENEEDEDYIYDEELNKTFNRTVEDITIDDISRHLET
LDIIQAKEDEEEQEQEHHGDNGQSHRARTRVPVNSHQRNSRNVSESSNSSSTQETGSNVG
GYKIPSNTTTRHLRSNRHSRLLNFDDSDISMISHGSPPRPKTRSSSSKNGGSNRW
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaagatccgttacataattttaaggttcagttcgaaaaatttgtggctagcaac
cctaatgtttcttccgtgacatcttctgcctcgaggatccctgaatcatctaaagccgta
atagttttatcaccatattctttatcacatcagttcccccgttattgggtatccaagtca
tacaaaaaaactattgtagaaagaccagagagattattagcatgttgtattggggtatct
gcagccattacgatgtatccggctttgttttctgtgaagacatcaaatcaccacaagact
tcgttattagcacctcatgtgttgaaagttcatgggaaagattggccgcgagaacttttg
aagctctgtaaagagtctgagaaaaaaattgataacgaagaagtagaggtaccccctgat
tggaatgtcggtgatatttatctttccaaacataccatagcagcgttggagggttctatc
ggagctttagaaattggtgtggattcgattttccaaggtgtgagtgttgagcagacagca
aatagagcatttatcgccattaggccaccaggacatcattctcatgcatccactccctct
ggattctgtctattaaacaacgcacatatcgcaatcgaatacgcttttgaaaaatacgat
gtcactcatgctgtaattcttgattttgatttacatcatggtgatggtactcaagacatt
tgttggaaacgtgcaggatttagaccagacgaattttccacagatgcagaacacggagca
tctgaagatgataacaagtacgatgaatttggaaaatccttcgctgagtttccgaaagta
ggttatttctccttgcatgatatcaactctttccccactgaacttggttatgccaccaaa
gaaaatattcgaaacgcatcaacgtgtatcatggatgcgcatgatatcaatatatggaat
gttcatctacagtcgtataaagacgaagaagagtttgtcaaactttatcagaccaaatac
agatctatctttgccaaggctgatgagtttttcaagaacgcaaaacttgaaatgaagcaa
ggtgggtttaggttcaaaggtcttgtcgtcatcagtgctggatttgatgccagtgaatac
gaacaacaatctatgcaaaggcacaatgtcaatgtcccaacaagcttctacaatctattt
acgaaggatgctttaaaactggcccaaatgcattctaacggtaagatcatttcagtcatg
gaaggtggttattcggacggtgccattgcatctggtgtcttttcacacttgattgggttc
caaaatcagaattggatcagcgagtggggttctgaacaagttgttaaggagattatcaga
ggttgtaaaccaagatggaagccatacaagacaaagaaagctcgggacgtaataaggatc
tgggctgaagaggtcatcatgcttggccgcagtatgattccagaattcgagaaagtgtta
ttcgatacagaggatactgtcactcacccagaagtcagactgaccagatccaagtaccat
gagacgattgtcaagcatgagaatgagatcccaagaacagagactcctactcctgtgcgc
agagaaaagccttcagaacaaccaaaggatgaaaacgtaccgtttgttgatcagatactg
cccagcgatgaagagaacgaggaagacgaagattatatttacgatgaggaattgaacaag
acgttcaatagaaccgtagaagacattacaattgacgatatctcgagacatttggaaacg
ttagacattatacaagcgaaagaagacgaagaggaacaggagcaagaacatcatggcgac
aacggtcaaagtcatcgtgcacgtaccagagttcccgtcaacagccatcagagaaacagc
agaaacgtctctgaatccagcaattcctcctcgacgcaggaaacgggatccaacgtaggc
gggtacaagattccgtcaaacacaacaacacgtcatttgcgcagcaatagacactcaagg
ttactgaactttgacgatagcgatatatcaatgatatcccatgggtctccgccacgccca
aagaccaggtcatcgtcctcgaagaacgggggctccaacaggtggtaa

DBGET integrated database retrieval system