KEGG   Kluyveromyces lactis: KLLA0_F04059gHelp
Entry
KLLA0_F04059g     CDS       T01025                                 

Definition
(RefSeq) uncharacterized protein
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
kla  Kluyveromyces lactis
Pathway
kla00500  Starch and sucrose metabolism
kla01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kla00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    KLLA0_F04059g
Enzymes [BR:kla01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     KLLA0_F04059g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_15
Motif
Other DBs
NCBI-GeneID: 2895703
NCBI-ProteinID: XP_455264
UniProt: Q6CLC5
LinkDB All DBs
Position
F:385832..387541
Genome map
AA seq 569 aa AA seqDB search
MNNPNTMLSKSSRKPRIPKHSHYFLSFVCISSLLAYYFLLSPFQAGNHNANHSIECPLSR
SSPLIEVSDFNRISEFKLQPIPVSKNISRNDFNKWLEEQTEISFYHMFENICHAETSDKF
DNCTPGVVFASPSKNKPDYFYHWIRDGAITINTLINTYLDIDRERTLETVLDYVNASLDL
QHKSNPSGPADDPLFRNLGEPKYHVDNSAYELVWGRPQNDGPPLRAIALLNFLNQVDDGE
TEKYNWIFDEVIALDLKFVLYNWHIPTYDLWEEVRAYHFFTSMVQLKALVEGKRYLLTSE
AKGVKLSKQLTILLKDIETCIDKIEDFIIDANSGFINHEKGYIVETPSILDERSGLDIAV
IMASTLTHDDSIKDMNTVYDSFLFDIDDPFILNHFNELIERMAVLYPINHNRLNTNMGVA
IGRYPEDIYDGIDISEGNPWFISTLTSAELIYKLVNKMYHDEKPLLIDPISNKFWTKFFE
FGNMKDSLILIPYNTLAFNQTLYTIFKYGDSFLSKVNEHVSNDGSMSEQFNKYHGYNQGA
PNLTWSYGTFSNALRWREIVDRFIHPIAI
NT seq 1710 nt NT seq  +upstreamnt  +downstreamnt
atgaataaccctaatacgatgctaagtaaaagctcaagaaaaccgagaatacctaagcac
tcacattattttctgtccttcgtttgcatttcttcgttattagcatactatttcctttta
tcaccatttcaagctgggaatcacaatgcgaatcacagtatagagtgccctttatcaagg
tcatctccactaattgaagtgtcagatttcaataggatatctgaattcaaattgcaacca
atcccagtctcgaagaacatttcaaggaatgatttcaataaatggttggaagaacaaacg
gagatttccttctatcatatgttcgaaaacatttgtcatgcagaaacatcagataaattt
gataattgtactcctggtgttgtctttgcgtctccttccaagaacaaaccagattatttc
tatcattggattagagatggtgccatcaccataaacactttaattaatacgtatcttgat
attgatagggaacggactcttgagacagtcttggattacgtgaacgcatctttggattta
caacataaatctaatcccagtgggccagctgatgatcctttgttcagaaatttgggagaa
ccaaaatatcatgttgataacagcgcttatgaacttgtctggggcagaccacagaatgat
ggcccaccattaagagctattgcattgttgaacttcttgaaccaggtagacgatggggaa
accgagaaatacaattggatatttgatgaggtaattgccttagatttgaagtttgtgtta
tataattggcatattccaacgtatgacctatgggaagaagtgcgtgcttatcattttttt
actagtatggttcaattgaaggcgctagtagaaggtaagagatatcttttaacgtcggaa
gcaaaaggtgtaaaattgagcaagcagttgactatactattgaaggatattgagacttgt
atagacaaaattgaggattttatcatcgatgccaattcagggtttataaatcatgaaaag
ggttacattgtggaaacccccagtattttggatgaaaggtcaggtttagacattgctgtg
atcatggcaagcaccttgacacatgatgattctataaaagatatgaacaccgtttatgat
tccttcttgtttgatattgatgatcctttcatattgaatcatttcaatgaactaattgag
agaatggcagtactttacccgatcaatcacaacagacttaatacaaacatgggagttgcc
attgggagatatccagaggatatttatgatggaattgacatctctgaaggtaatccctgg
tttatctcaacgttaacctctgccgaattgatttacaaattagtcaataaaatgtatcac
gatgagaaacctttactcattgatccgatatcgaacaagttctggactaaattcttcgaa
tttgggaatatgaaggattcgctgatcttgataccatataatacattagcgttcaaccaa
acgttgtacacaatattcaaatacggtgattcattcctaagcaaagttaacgagcatgta
agtaacgacggatcgatgagcgaacagttcaacaaatatcatggatacaaccaaggggct
ccaaatttgacatggtcttacggtactttcagcaatgcacttcgctggagggaaattgtc
gatcgattcatccatcctattgccatataa

DBGET integrated database retrieval system