KEGG   Kluyveromyces lactis: KLLA0_F17006g
Entry
KLLA0_F17006g     CDS       T01025                                 

Definition
(RefSeq) uncharacterized protein
  KO
K12766  serine/threonine-protein kinase MDS1/RIM11 [EC:2.7.11.1]
Organism
kla  Kluyveromyces lactis
Pathway
kla04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:kla00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04113 Meiosis - yeast
    KLLA0_F17006g
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:kla01001]
    KLLA0_F17006g
Enzymes [BR:kla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     KLLA0_F17006g
Protein kinases [BR:kla01001]
 Serine/threonine kinases: CMGC group
  GSK family [OT]
   KLLA0_F17006g
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Choline_kinase APH
Other DBs
NCBI-GeneID: 2895637
NCBI-ProteinID: XP_455844
UniProt: Q6CJP5
LinkDB
Position
F:complement(1561859..1563106)
AA seq 415 aa
MKVGELLESSGAGGSRSIIAYTNDKNAGFETEMDSILPSDDLKQGSLHSKNSHGNDVKIV
PDEDEVITRRTVVKGHSNPEESVVISCGTPEIVGNGSFGVVFRTKVKETGEDVVIKKVLQ
DRRFKNRELEIMKLISHPNLIDLKYYFLEQSDQELYLNLIVDYMPMSLYQRLKEFISLHQ
PMDRYEIKIYMFQLFKSLNYLHQVVNVCHRDIKPQNILVDPDTLLLKICDLGSAKQLKPN
EPNVSYICSRYYRAPELIFGATNYTTKIDIWSAGCVMAELLLGQPIFPGESKIDQLVEII
KVLGTPTREEICSMNENYSEHKFPQIRPIPLNRIFKKETQETIDLLYHIMKYDPNIRYSA
LQCMFNSTYFTDIVSNTGSDSNLSLIDSLPLLHFEESELQGLSSNDIYRLTGKLI
NT seq 1248 nt   +upstreamnt  +downstreamnt
atgaaagttggtgaattgctcgaaagtagcggtgccggtggttcaagatctattattgca
tatactaacgataaaaacgctggttttgagacagagatggattccattttacccagtgat
gatttaaaacaaggcagtcttcatagtaagaacagtcatggtaatgatgttaaaatcgtt
ccagatgaagacgaagtaataacccgaaggactgtggtgaaaggccattccaaccccgag
gagtcagttgttatttcatgcggcacacctgaaattgtgggaaatggttcgtttggtgtc
gttttcagaacaaaagtgaaagagactggggaggatgttgtcattaagaaggttctacag
gatagacggtttaagaatagagaactggagatcatgaaattgatcagtcatccgaatttg
atcgatttgaagtactatttccttgaacaatcggaccaagaactttatctaaatttgatt
gtagattacatgcccatgtctctttatcaacggctcaaagagttcatttccttgcatcaa
ccaatggatcgttacgaaatcaagatttacatgttccaattgttcaaatctttaaactat
ttgcatcaagtggtcaatgtctgccatagagacatcaaaccacagaatattttggtggat
ccagatactttactgttgaaaatctgtgatttggggtctgctaaacagttgaaaccaaac
gagcccaatgtgtcatatatttgctcccgttactacagagccccagagttgatctttggt
gctaccaattacacaacaaagattgatatttggtctgcaggttgtgttatggctgaactg
ctattaggacaacccattttccctggtgaatctaagatcgatcaattggttgaaattatt
aaagttttgggtacaccaaccagggaagagatctgttccatgaatgaaaactactccgaa
cataagttccctcagatcagaccgatcccattgaataggatcttcaagaaggaaacacag
gaaactatagacttattataccatatcatgaaatatgatcctaatatcagatacagcgct
ttacaatgtatgttcaattcgacgtacttcactgatatcgtcagcaacaccgggtcggac
tcaaacctttcgttgatcgattctttaccattgctacattttgaggaaagtgaattacaa
gggttgtcatctaacgatatatatagattgactggcaaactgatatag

DBGET integrated database retrieval system