KEGG   Kluyveromyces lactis: KLLA0_F17930gHelp
Entry
KLLA0_F17930g     CDS       T01025                                 

Definition
(RefSeq) uncharacterized protein
Organism
kla  Kluyveromyces lactis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dopey_N CsgA DUF1729
Motif
Other DBs
NCBI-GeneID: 2895603
NCBI-ProteinID: XP_455884
UniProt: Q6CJK5
LinkDB All DBs
Position
F:1638931..1643925
Genome map
AA seq 1664 aa AA seqDB search
MSLPLRPLSLDVNTKQLDSKQKKFHQAVERALQHFDAVTEWADYISSLGKLLKALQSWSP
KFQNVKYYVPYPYQVARRLSSSLSPNLPSGVHLKTLEVYNYIFEKIGPDTLGKEVNIWIG
GVLPLMSYASISVKHPLIELYEKYIVSLSSVTLKIIVKPVLASLFPGIDDESSESQASTI
NLIETLYTNLDDPSLFWQTSFIIIINNKDRRLGGLVWLTKKLPSLNAVPHLAAKEKDTAL
TKKDSKERKEFALSLLLDASKPVVSPEPGLLIRSFVRCLEDENEILIQRGILDLLLQRLH
LHSPLLQVLVKPSDCRLLIMTACRTMLKKDMSLNRRIWNWLLGPVLDPESGDHSDSEYFI
KNGAQHLLGGLHEMLEHPQTCIDAYKIVSALMDRWQIGSYLTPKIFIPLIEKCREYSDNQ
LVLKTASSFFDSVETNIIWGKLFEKVFCDNDYDLLIYVLQNFRCSTDEEITVRHLPLILL
SLLCQSSIEIPKCTQILEILVRMIPERAYLPIHHSSLSQGSTLSYEKCFTDIKSYYEQVS
DPLNSKDLNSSSDLSPPFNTADLTFLITYRVHLLLIENIRRYQNINDISKLFVLFIEIIP
EQYDVSEEAEVVKWSDTDLIECIFEQNDAIESAPEQSLQGIVEIYTKYLFRNLPILDSMR
LLKIIMKGLWSLLLDHNKQIDAVEMLKVITRHVPSSRIESCLASVYLGDCDINNRLVVLD
CLWTHLAGNFDIIKRPLSLALDELSDEKNSNYWYVHEWVVSIISGESGNKFFELLVENPL
QFEFINNEKIGNMDDLALFTYHLDVLRNVLKTPDTVVYKAFGIQLVTEKLSKDWAAEDVS
SYKSLVIAVLLKFLSIQNDAPGNSIKSALSLLSLLVNGTEINFKNIVTRLLQISTEYIAS
KVPDSQVVVVSLLQIISQVLSLSDKRQIKLDIFTEDSSHMKYVDFLVSTVSHIDDDLVFS
SYVNLLSESIAYFQESILKIILPLSASIVDSISRLFEDEQKRGKNLRSITALLGSLEEIL
EVSHGYLQADESTGYFSHTNARNDFLQNMVSNVFSSDQSSSEARILNERMVVLKSFTMVS
GRISEMWNWADQTASGDLRTVNNSEFGQSLHEVSTNYKVISNKLLEKLFLLEPSDILESL
ISNPIPSQLVRLNHSLDNGRCSVTISRLLQGIVTRCNETSSVSLFSSHRSKKNLNSAETN
HLGAGDLLSYLLKYFDSLDNSAVEDFYSDFMVFLKEVLSNYTSYSSISFPLLQLIALISE
KLDYSSLGQERRVRKEITESFIKLLNNSLSSDIMDSNNKEDIIAALYFVVERLSYVVNEV
NQGDKFNSTLTSIVIYSIVPYSKRIAEISPDVLHFMNLIAPIGERVKPWKLFLNEFFTDS
KTLRALLETDDKSWSFIFYHWSLYYDSKEKLLPDLILSVTAKSNVITPSINPFNTWSDSE
VQSKFNNILRIAYLVLISPKDHYYIHCQSLLNIVEHFIFGVENALQAAGYILLRALLLKF
TNTHFADHWSMLFSGLQSSLLTIYEAIQVQQSIDSNVVLQVSKTLDLLLTVNVEEFSATH
EWLFVIDTINSIYKKDPYVALVDEISQCKDLVMVTTSGVTLNEDTTFRVPLLVNIHSIDS
VVNLIPFFFNLSYDHYEAMYNLNPLNEQVCIDDLSHDICHQFIK
NT seq 4995 nt NT seq  +upstreamnt  +downstreamnt
atgtcgttgccattgaggcccttgtctctagatgtgaacacaaagcagctagattctaaa
cagaagaagttccaccaggctgtggaaagggcattgcaacatttcgatgctgtcacggaa
tgggctgactatatcagcagcttaggaaagcttctcaaggctttacaaagttggtctcct
aaattccagaatgttaaatactacgttccatatccttatcaggttgctagaagattgtct
tcatcattatctccaaacttaccttcaggagttcatttgaaaacattagaggtttataat
tacatttttgagaagattgggcccgacactttggggaaggaagtgaatatttggataggt
ggcgttctacccttgatgtcttatgcgtccatatcggttaaacatccattgattgaactg
tatgagaaatacattgtaagtctatcttctgttacgttgaaaattatagtgaaacctgtg
ttggcaagtttgttcccagggatcgacgacgaaagtagtgagtcgcaagcaagtaccata
aatttgatagagactctttacactaatctagatgatccctctttattttggcaaacttct
ttcattattataatcaataataaagatagaagattgggcggtctagtgtggttgacgaaa
aagttaccatcgttaaatgcagttcctcatttagctgcaaaggaaaaggacacagcttta
actaaaaaggattcgaaggagaggaaagaatttgctttgtcgttgttactcgatgcctcc
aaaccagtagtttcacccgagccaggtttgctaataagatcttttgttagatgtcttgaa
gatgagaacgaaatcctaatccaaagaggtattttggacttacttttgcaaaggttgcat
ttgcattcaccattgttgcaagtgttagttaaaccttccgactgtcggctcttaatcatg
acggcatgcagaacaatgttgaaaaaagacatgtctctcaatagaagaatatggaactgg
ctgcttggaccagtactagatccagaatctggagatcatagcgattccgagtattttatc
aagaacggtgctcaacatttgttaggcggattgcatgagatgctcgaacaccctcagacg
tgcatcgatgcttacaaaatcgtgtctgcgttgatggatcgctggcaaattggatcttat
ttaacaccgaaaatattcatcccacttatcgagaaatgcagagagtactcggacaatcaa
ttagtattgaaaacagcgtcttctttctttgattctgtcgaaactaatatcatttggggg
aagcttttcgaaaaagtgttttgcgataatgactatgaccttctaatatatgtgctacaa
aatttccgctgttccactgatgaagaaataacagtacgtcacttgccgctaattctacta
tcgttactatgtcagagttcgattgaaattccaaagtgtactcaaatattagaaattctt
gtacgaatgatacctgaaagagcctacttgcccattcatcactcttctttatcccaggga
agcacgctatcctatgagaaatgctttactgatatcaaatcttactatgaacaggtgtca
gatcctcttaattccaaagatctaaattcgtcatctgatttaagtcctcctttcaatacg
gcagatctaacttttttaatcacttatagagtgcatttactgttgatcgaaaatattcga
agatatcaaaacataaatgatatttcgaaattgtttgtattattcattgaaataatcccc
gagcagtatgatgtatcagaagaagctgaagtggtgaagtggtcagatactgatttgata
gagtgtatctttgaacaaaatgatgcaatcgaaagtgctcctgaacagtcactacaagga
attgttgagatttacactaaatatttgttccgtaatttaccgatattggattcgatgcga
ctattaaagataattatgaaagggctgtggtcattactcttagatcataataaacaaatt
gacgcagtcgaaatgctcaaagtcataacaagacatgttccatcgtcaagaattgaaagc
tgcttagcttctgtttatttgggggattgcgacattaacaatcgtctagttgttctagac
tgcctctggactcatctagcaggtaactttgatattataaaaagacctttgtccctagct
ttggacgaactttctgatgaaaagaattctaactactggtatgtgcatgaatgggtggta
tctatcatttctggtgaatccggaaacaagttctttgaacttttggttgaaaaccccctt
caatttgagtttataaataacgaaaagattggcaatatggacgatttggcgctatttact
tatcatcttgatgttttgagaaatgttttaaaaaccccagacactgtggtctataaagct
ttcggaattcaattagtaactgaaaaattatccaaggactgggcggccgaagacgtatcg
tcatataaaagcttggttattgctgtgctgctaaaatttctaagtatccaaaatgacgca
cctggcaatagcataaaaagtgcattatctcttttaagtttgcttgtcaacggtactgaa
ataaatttcaagaacattgtgacgagattgctccaaatttctacggaatacattgccagt
aaagttcctgattctcaagttgttgtcgtatctttgctacaaataatctcacaggtgcta
tctttatcggataaaagacaaattaagcttgacatctttaccgaggactcttcgcatatg
aaatatgttgattttcttgtatctacagtaagtcatattgatgatgacttagtcttttca
tcctatgtcaatttactttccgagagcattgcttacttccaagagtcaatcctcaagatc
attttgcctttgtctgcatccatagttgactccatatctagactttttgaagacgagcag
aaaaggggtaaaaacttgaggtctataactgctcttctaggatctttagaagaaattcta
gaagtgtcgcatggctatttgcaagctgatgaaagcaccggttatttctctcacaccaat
gcaagaaatgattttttgcagaacatggtatccaatgtgttttcatcggatcaatcctct
tctgaagcacgaattttaaatgagagaatggtcgttcttaaatcttttacaatggtaagc
ggcagaatatcagaaatgtggaattgggctgaccaaacagcatctggagacttgaggacg
gtcaataactcagagtttggccagtcattacacgaagtttcgacaaactacaaagttatc
tcaaataagctacttgaaaagcttttcctattagaaccatcagatattttggaatcctta
atttcgaacccaattccttctcagctcgttagactaaatcactctttggataacggacgg
tgctcagtgacaatttcccgtttgctacaaggtatagtaacgagatgtaatgagactagc
tctgtgtctttattcagcagtcatagaagcaaaaagaaccttaactctgcagagacaaat
caccttggcgcgggggatttattatcatatttgctcaaatattttgactcgttggataat
tcggcagttgaagacttttattcagattttatggttttcttaaaggaagttttgagtaac
tatactagctatagttcaatatcgtttccgttattgcaattaattgccttaatcagcgaa
aaacttgactactctagtttgggtcaagaacgccgagtcagaaaggaaataactgaatca
tttattaagttactaaacaatagtctcagctcggatattatggatagcaacaataaagaa
gacattatagcagctttgtattttgttgttgagaggctttcatatgttgtcaatgaagtt
aatcaaggtgataagttcaacagcactttgacctccattgttatctattccatagtgcct
tacagcaaaaggatagcagaaatctcccccgatgtattgcacttcatgaatttgatagca
ccaatcggagagagagttaaaccttggaaattattccttaacgaatttttcacggattct
aaaacgttacgggcgctgttagagacagatgacaaatcttggagtttcatattttaccac
tggtctctatactacgatagcaaggagaaacttcttccagatctaatattgtccgtaacg
gcgaagtcgaatgttattacaccttcaatcaatccgtttaacacatggagtgattcagaa
gttcaatccaaatttaacaatattctacgcattgcgtatttggttctcatttctccgaaa
gatcattattatattcactgtcaatcacttttgaacattgttgaacatttcatctttgga
gtagagaatgcattacaagccgctggatatatattattacgggctttactattgaaattt
acaaacacacatttcgctgatcattggtcgatgttattctcaggtttacaatcatcttta
ctcacaatatatgaagctatacaagttcaacaatccattgacagtaatgttgtccttcaa
gtatcgaagactcttgatcttcttctaaccgttaacgtagaagaattttctgccactcat
gagtggttattcgtcattgacactattaatagtatttacaagaaggatccttatgtcgcg
ctagtagacgagataagccaatgtaaagatttggtaatggtcacgacgtcgggtgttaca
ctgaatgaagatactacattccgtgttcccttgctagtcaacatacattccattgacagc
gttgtaaacctcattcctttcttcttcaatctcagttacgatcactatgaagcgatgtac
aacttaaaccccttgaacgaacaggtatgtattgatgatttatcgcatgacatttgtcat
caattcattaagtga

DBGET integrated database retrieval system