KEGG   Kluyveromyces lactis: KLLA0_F17974gHelp
Entry
KLLA0_F17974g     CDS       T01025                                 

Definition
(RefSeq) uncharacterized protein
  KO
K12158  ubiquitin-like protein Nedd8
Organism
kla  Kluyveromyces lactis
Brite
KEGG Orthology (KO) [BR:kla00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:kla04121]
    KLLA0_F17974g
Ubiquitin system [BR:kla04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitin-like proteins (UBLs)
   KLLA0_F17974g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ubiquitin Rad60-SLD Ubiquitin_2 TBK1_ULD Ubiquitin_4 Rad60-SLD_2 YukD
Motif
Other DBs
NCBI-GeneID: 2895582
NCBI-ProteinID: XP_455886
UniProt: Q6CJK3
LinkDB All DBs
Position
F:join(1644903..1645051,1645153..1645237)
Genome map
AA seq 77 aa AA seqDB search
MQLKVKTLTGKEISVDVQSSETVYHIKELLEEKEGIPPSQQKLIFQGKQIDDNATIGSAD
LQDGSLLHLVLTLRGGC
NT seq 234 nt NT seq  +upstreamnt  +downstreamnt
atgcaattaaaggtcaagacattaacagggaaggaaatctccgtagatgttcaaagttca
gaaacggtctatcatatcaaagagctattagaagaaaaagagggtattccaccatcacag
cagaagttgatcttccagggcaaacaaatagatgataacgcaacaatcggcagtgccgac
ttgcaagatggatctcttttacatcttgttctaactttaagaggcggttgttga

DBGET integrated database retrieval system