KEGG   Enterobacter lignolyticus G5: AO703_00405Help
Entry
AO703_00405       CDS       T04198                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
kle  Enterobacter lignolyticus G5
Pathway
kle00620  Pyruvate metabolism
kle00680  Methane metabolism
kle01100  Metabolic pathways
kle01120  Microbial metabolism in diverse environments
kle01200  Carbon metabolism
Module
kle_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:kle00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    AO703_00405
  Energy metabolism
   00680 Methane metabolism
    AO703_00405
Enzymes [BR:kle01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     AO703_00405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ALR74847
LinkDB All DBs
Position
complement(91632..94283)
Genome map
AA seq 883 aa AA seqDB search
MNEQYSALRSNVSMLGKVLGETIKDALGENILDRVETIRKLSKSSRAGNEANRQELLTTL
QNLSNDELLPVARAFSQFLNLANTAEQYHSISPNGEAASNPEVIARTLRKLKDQPDLNDA
TIKKAVESLSLELVLTAHPTEITRRTLIHKMVEVNSCLKQLDNKDIADYERHQLMRRLRQ
LIAQSWHTDEIRKLRPSPVDEAKWGFAVVENSLWEGVPNYLRELNEQLEANLGYRLPVDF
VPVRFTSWMGGDRDGNPNVTADITRHVLLLSRWKATDLFLKDVQVLISELSMVEATPELR
ALAGAEGEQEPYRHLMKNLRSQLMATQTWLEARLKGEKLPKPAGLLTQNEQLWEPLYACY
KSLQACGMGIIANGELLDTLRRVKCFGVPLVRIDIRQESTRHTEALGELTRYLGIGDYES
WSEADKQAFLIRELNSKRPLLPRQWEPSDETREVLDTCKVIAEAPKGSIAAYVISMAKTP
SDVLAVHLLLKEAGIGFALPVAPLFETLDDLNNANDVMTQLLNIDWYRGFIQGKQMVMIG
YSDSAKDAGVMAASWAQYQAQDALIKTCEKAGIELTLFHGRGGSIGRGGAPAHAALLSQP
PGSLKGGLRVTEQGEMIRFKYGLPEVTISSLSLYTSAILEANLLPPPEPKAEWRHIMNEL
SDVSCKMYRGYVRENKDFVPYFRSATPEQELGKLPLGSRPAKRRPTGGVESLRAIPWIFA
WTQNRLMLPAWLGAGAALQQVVAGGKQSELETMCRDWPFFSTRLGMLEMVFSKADLWLAE
YYDQRLVTKALWPLGAELRKLLEGDIKVVLDIANDSHLMADLPWIAESIQLRNIYTDPLN
VLQAELLHRSRQAEEAGEAPDPRVEQALMVTIAGVAAGMRNTG
NT seq 2652 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaacaatattccgctttgcgcagtaatgtcagtatgctcggtaaggtgcttggt
gaaaccatcaaggacgcacttggcgagaacattcttgatcgtgtagaaaccatccgtaag
ctgtcgaaatcctctcgagccggtaacgaagcaaaccgccaggagctgctcaccacgttg
caaaatctgtccaacgatgagctgctgccggtcgcgcgcgcgttcagccagtttctgaat
ctggccaacaccgccgagcagtatcacagcatttcaccgaacggcgaagcggccagtaac
cctgaagtgatcgcgcgtacgctgcgaaaactgaaagaccaacccgacctcaacgacgct
accatcaaaaaagcggttgagtctctgtccctggagctggtgctgaccgcgcacccgacg
gagatcacccgccggacgcttatccacaaaatggtggaagtgaacagctgcctaaagcag
ctggataacaaagacattgccgactacgaacgccaccagctgatgcgccgtctgcgccag
ctgatcgcgcagtcctggcataccgatgaaattcgtaagctccgtccaagcccggttgat
gaagccaagtggggctttgcggtggtggaaaacagtctgtgggaaggcgtgccgaactac
ctgcgcgagctgaacgaacagctggaagcgaatctgggctaccgcctgccggtggatttc
gtcccggttcgcttcacctcctggatgggcggcgaccgcgacggcaacccgaacgtaacc
gctgacattacccgccatgtgctgctgctaagccgctggaaggccaccgatctgttcctg
aaagacgtccaggtgctgatttccgagctgtcgatggtggaagcgactccggagctgcgc
gccctggctggcgcggaaggcgagcaggagccgtatcgccacctgatgaaaaacctgcgc
agccagctgatggcgactcagacctggctggaagcgcgcctcaagggcgagaagctgcca
aaaccggccggtctgctgacgcaaaacgaacagctctgggaaccgctgtacgcttgctat
aaatccctgcaggcctgcgggatgggcatcatcgccaacggcgagctgctggacaccctt
cgccgtgtgaagtgtttcggcgtaccgctggtacgtatcgacatccgtcaggaaagcacc
cgtcacaccgaagcgctgggcgaactgacccgttacctcggcatcggcgactacgaaagc
tggtcggaagccgacaagcaggctttcctgatccgcgaactgaactccaagcgcccgctg
ctcccgcgccagtgggaaccgagcgacgagacccgcgaggtcctcgacacctgcaaagtc
attgccgaagcgccaaaggggtccatcgccgcttatgtgatttccatggccaaaacgccg
tccgacgtgctggcggtacacctgctgctgaaagaggccggtatcggcttcgcgctgccg
gtcgccccgctgtttgaaaccctggacgacctcaacaacgccaacgacgtgatgacgcag
ctgctgaacatcgactggtatcgcggcttcatccagggcaagcagatggtgatgattggc
tactccgactcggcgaaagacgcgggcgtgatggccgcctcctgggcgcagtaccaggcg
caggacgcgctgatcaaaacctgcgaaaaagccggtatcgaactgacgctgttccacggc
cgcggcggctctatcggccgcggcggcgcgcctgcgcacgcggcgctgctctcgcagccg
ccgggaagcctgaaaggcggcctgcgcgttaccgagcagggcgagatgatccgcttcaag
tacggcctgccggaagtcaccatcagcagcctgtcgctgtacaccagcgcgattctggaa
gccaacctgctgccgccgccggagccgaaagccgaatggcgccatatcatgaacgagctg
tcggacgtctcctgcaagatgtaccgcggctatgtccgtgaaaacaaagatttcgtcccc
tatttccgttccgccacgccggagcaggagctgggtaaactgccgctgggctcacggccg
gccaaacgccgtccgaccggcggcgtcgagtccctgcgcgccattccgtggatcttcgcc
tggacccagaaccgcctgatgctgccggcctggctgggcgcgggcgcggcgctgcaacag
gtggtagccggcggtaagcagagcgaactggagaccatgtgccgcgactggccgttcttc
tccacccgcctgggcatgctggagatggtgttctctaaagccgacctgtggctggcggaa
tactacgatcagcgtctggtgaccaaagcgctgtggccgctcggcgctgagctgcgcaag
ctgcttgagggcgacatcaaagtggtgctggatatcgccaacgactcccacctgatggcc
gacctgccgtggattgccgaatccatccagctgcgtaacatctacaccgacccgctgaac
gtgctgcaggccgaactgctgcaccgttcgcgccaggcggaagaagcaggcgaagcgccg
gacccacgcgttgagcaggcgctgatggtgacgattgcaggcgttgcggcggggatgcgt
aacaccggctaa

DBGET integrated database retrieval system