KEGG   Enterobacter lignolyticus G5: AO703_00930Help
Entry
AO703_00930       CDS       T04198                                 

Gene name
fadB
Definition
(GenBank) multifunctional fatty acid oxidation complex subunit alpha
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
kle  Enterobacter lignolyticus G5
Pathway
kle00071  Fatty acid degradation
kle00280  Valine, leucine and isoleucine degradation
kle00281  Geraniol degradation
kle00310  Lysine degradation
kle00362  Benzoate degradation
kle00380  Tryptophan metabolism
kle00410  beta-Alanine metabolism
kle00640  Propanoate metabolism
kle00650  Butanoate metabolism
kle00903  Limonene and pinene degradation
kle00930  Caprolactam degradation
kle01100  Metabolic pathways
kle01110  Biosynthesis of secondary metabolites
kle01120  Microbial metabolism in diverse environments
kle01130  Biosynthesis of antibiotics
kle01200  Carbon metabolism
kle01212  Fatty acid metabolism
Module
kle_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:kle00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    AO703_00930 (fadB)
   00650 Butanoate metabolism
    AO703_00930 (fadB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AO703_00930 (fadB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AO703_00930 (fadB)
   00310 Lysine degradation
    AO703_00930 (fadB)
   00380 Tryptophan metabolism
    AO703_00930 (fadB)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AO703_00930 (fadB)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    AO703_00930 (fadB)
   00281 Geraniol degradation
    AO703_00930 (fadB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AO703_00930 (fadB)
   00930 Caprolactam degradation
    AO703_00930 (fadB)
Enzymes [BR:kle01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     AO703_00930 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     AO703_00930 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     AO703_00930 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     AO703_00930 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: ALR74938
LinkDB All DBs
Position
complement(199478..201667)
Genome map
AA seq 729 aa AA seqDB search
MLYKGDTLYLDWLEDGIAELVFDAPGSVNKLDTATVASLGQALDVLEKQKDLKGLLLRSE
KAAFIVGADITEFLSLFQVPQEQLSQWLHFANSVFSRLEDLPVPTLSAVNGYALGGGCEC
VLATDYRLATADLRIGLPETKLGIMPGFGGSVRLPRMLGADSALEIIVAGKDVGAEEALK
IGLIDGIVKPEKLRDGAVAMLRQAIDGALDWKAKRQPKLEPLRLSKIEAAMSFTIAKGMV
AQTAGKHYPAPMTAVKTIEAAARFGRDEALALENQSFVPLAHSSEARALVGIFLNDQFVK
SQAKKLTKKVETPKQAAVLGAGIMGGGIAYQSAWKGVPVIMKDINDKSLTLGMTEAAKLL
NKQLERGKIDGLKLAGVISTIHPTLDYAGFERVDVVVEAVVENPKVKKAVLAETEDKVRP
DAVLASNTSTIPISELAHALKRPENFCGMHFFNPVHRMPLVEVIRGEKTSDDTIAKVVAW
ASKMGKTPIVVNDCPGFFVNRVLFPYFAGFSQLLRDGADFRKVDKVMEKQFGWPMGPAYL
LDVVGIDTAHHAQAVMAAGFPQRMQKDYRDAIDALFDASRYGQKNGLGFWRYKEDSKGKP
KKEEDPAVDGLLAEVSKPKRDFTDEEIVARMMIPMVNEVVRCLEEGIIASPAEADMALVY
GLGFPPFHGGAFRWLDTLGSAKYLDMAQQFQHLGALYEVPAGLRDKARHNEAYYPPVEPA
RPVGELKTA
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgctctacaaaggcgataccctgtacctcgactggctggaagatggcattgccgaactg
gtgttcgatgcccccggctcggtcaataagctcgatacggcaaccgtagccagcctcggc
caggcgctggacgtcctcgaaaaacaaaaagatctcaagggcctgctgctgcgctctgaa
aaagccgcgtttatcgtcggcgccgatatcaccgaattcttatccctgttccaggttccg
caggaacagttaagccagtggctgcatttcgcaaatagcgtctttagccgcctggaagac
ctgccggtccctaccctctccgccgtcaacggctacgcgcttggcggcggctgcgaatgc
gtgctggcgaccgattatcgcctggcaaccgccgatctgcgcatcgggctgccggaaacc
aaactgggcattatgcccggctttggcggctcggttcgcctgccgcgcatgctcggcgcc
gacagcgcgctggagatcatcgtcgcaggtaaagacgtcggcgcggaagaagcgctgaaa
attggcctgatcgacggcattgtaaaacccgagaaactgcgcgacggcgcggtggcgatg
ctgcgtcaggctatcgacggcgcgcttgactggaaagccaagcgccagccaaagctggag
ccgctgcgcttaagcaaaattgaagccgccatgagcttcaccatcgccaaaggcatggtg
gcgcagacggccggcaaacattacccggcgccgatgacggcggtaaaaaccattgaagcg
gcagcccgctttggccgcgacgaggccctggcgcttgagaaccagagttttgttccgctg
gcgcactccagcgaagcccgcgcgctggtcggaatcttcctgaacgatcagtttgtcaaa
agccaggcgaaaaagctgaccaaaaaagttgagacgccaaaacaggccgccgtactgggc
gcaggcatcatgggtggcggtatcgcttatcagtcggcctggaagggcgtgccggtcatt
atgaaggacatcaacgataagtctctgacgctcggcatgaccgaagcggcaaagctgctt
aacaaacagctggagcgcggaaaaatcgacggcctgaagctggcgggggtcatttcgacc
attcacccaacgctggactatgccggttttgagcgcgtcgatgtggtcgtagaggcggtt
gttgaaaacccgaaagtgaaaaaagcggtgctggcggaaaccgaagacaaggttcgcccg
gacgccgtgctggcctcgaacacctcgacgatccccattagcgaactggcgcacgccctg
aagcgcccggaaaacttctgcggcatgcacttctttaacccggtacaccgcatgccgctg
gttgaggtgattcgcggcgagaagacctctgacgataccatcgccaaagtcgtggcatgg
gcgagcaaaatgggcaaaacgccgatcgtggtgaacgactgccccggattctttgtcaac
cgcgtgctgtttccgtactttgccggcttcagccagctgctgcgcgacggcgcggatttc
cgcaaagtcgataaagtgatggaaaaacagttcggctggccgatgggcccggcgtatctg
ctggacgtcgtcggtatcgacaccgcgcaccacgctcaggcggtgatggcggcggggttc
ccgcagcggatgcagaaagattaccgcgacgctatcgatgcgctgtttgatgccagccgc
tatggccagaaaaacggtctcggcttctggcgttataaagaagacagcaaaggcaagccg
aaaaaagaagaagacccggccgtggacggcctgctcgccgaggtcagcaaaccaaaacgc
gacttcaccgacgaagagatcgtcgcccgcatgatgattccgatggtcaacgaagtggtg
cgctgtctggaagaaggcattatcgcaagcccggcggaagccgatatggcgctggtgtat
ggtttaggtttccctccgttccacggtggcgccttccgctggctggataccctgggcagt
gcgaagtatctcgatatggcgcagcagttccagcacctcggcgcactgtatgaggtaccg
gcaggcctgcgcgacaaagcgcgccataacgaagcatattatcccccggttgagcccgcc
cgtccggtcggcgagctgaaaacggcttaa

DBGET integrated database retrieval system