KEGG   Enterobacter lignolyticus G5: AO703_01375Help
Entry
AO703_01375       CDS       T04198                                 

Gene name
alr
Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
kle  Enterobacter lignolyticus G5
Pathway
kle00473  D-Alanine metabolism
kle01100  Metabolic pathways
kle01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:kle00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    AO703_01375 (alr)
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    AO703_01375 (alr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:kle01011]
    AO703_01375 (alr)
Enzymes [BR:kle01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     AO703_01375 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:kle01011]
 Precursor biosynthesis
  Racemase
   AO703_01375 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: ALR75013
LinkDB All DBs
Position
298729..299808
Genome map
AA seq 359 aa AA seqDB search
MQAATVVINRRALRHNLQRLRELAPASKLVAVVKANAYGHGLLETARTLPDADAFGVARL
EEALRLREGGITQPILLLEGFFNAGDLPVISAQRLHTAVHNLEQLEALEQATLPEPVTVW
MKLDTGMHRLGVRPEEAEAFYQRLSQCQNVRQPVNIVSHFARADEPECGATERQLDVFNT
FCDGKPGMRSIAASGGILLWPQSHFDWVRPGIILYGVSPLEGKPWGPDFGLQPVMSLTSS
LIAVREHKAGEPVGYGGTWESARDTRLGVVAMGYGDGYPRAAPSGTPVLVNGREVPIVGR
VAMDMICVDLGPQAQDRAGDPVVLWGEGLPVERIAELSKVSAYELITRLTSRVAMKYVD
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcggcaacagttgttattaaccgccgcgctctgcgacacaacctgcaacgtctg
cgtgaactggcgcccgccagcaagctcgttgcggtcgtgaaagcgaacgcctatggacac
ggtcttctggagaccgcgcgaacgctccccgatgccgacgcctttggcgtcgcccgtctg
gaggaggcgctgcgcctgcgcgaggggggaatcacgcaacccatcctcctgctcgaagga
ttctttaatgccggcgatctgccggttatctcggcacagcgcctgcataccgcggtgcat
aacctggagcagctggaagcgctggagcaggcgacgctgccggaaccggtcaccgtctgg
atgaagctggataccggcatgcaccgcttaggcgtacgcccggaagaggctgaggctttt
tatcagcgcctgagccagtgccaaaacgtgcgtcagccggtcaatatcgtcagccacttc
gcccgcgccgacgaaccggaatgcggcgcgaccgaacgccagctcgacgtgttcaacacc
ttctgcgacggcaagccgggtatgcgttctatcgccgcttccggcggtatcctgctgtgg
ccgcagtcgcatttcgactgggtccgtccgggtattatcctgtacggcgtttcgccgctg
gagggcaaaccctgggggccggatttcggcctgcagccggtgatgtccctgacctcaagc
cttatcgccgtacgtgagcataaagccggtgagccggtcggctatggcggcacctgggaa
agcgcgcgcgatacgcgccttggcgtggtggcgatgggctacggcgatggctacccgcgc
gcggcgccgtcgggcaccccggtgctggtaaacggtcgtgaagtgccgatcgtcggccgc
gtggcgatggatatgatctgcgtcgacctcgggccgcaggcgcaggacagagcgggcgac
ccggtcgtgctgtggggcgaagggctaccggtcgagcggatagcggagctttcgaaagtg
agtgcttacgaacttatcacgcgcctgacgtcgcgggtggcgatgaaatacgtcgactaa

DBGET integrated database retrieval system