KEGG   Enterobacter lignolyticus G5: AO703_04845Help
Entry
AO703_04845       CDS       T04198                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
kle  Enterobacter lignolyticus G5
Pathway
kle00473  D-Alanine metabolism
kle00550  Peptidoglycan biosynthesis
kle01100  Metabolic pathways
kle01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:kle00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    AO703_04845
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AO703_04845
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    AO703_04845
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:kle01011]
    AO703_04845
Enzymes [BR:kle01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     AO703_04845
Peptidoglycan biosynthesis and degradation proteins [BR:kle01011]
 Precursor biosynthesis
  Amino acid ligase
   AO703_04845
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATPgrasp_ST ATP-grasp_4 GARS_A PTS_2-RNA
Motif
Other DBs
NCBI-ProteinID: ALR75655
LinkDB All DBs
Position
complement(1071237..1072337)
Genome map
AA seq 366 aa AA seqDB search
MAKLRVGVVFGGKSSEHEVSLQSAKNIVEAMDKTRFDVVLLGIDKQGQWHINDASNYLLN
DHDPAHIALRPSDVTLAQIPGKESQQLINADSGQPLPAIDVIFPIVHGTLGEDGSLQGML
RMANLPFVGSDVLGSAACMDKDVTKRLLRDAGLSIAPFITLTRANRQRVTFAEVSEKLGL
PLFVKPANQGSSVGVSKVKNEAQYQQAVALAFEFDHKVVVEQGIIGREIECAVLGNDEPQ
ASTCGEIVLNSEFYAYDTKYIDDNGAQVVVPADISQAINDKIRAIAIQAYQTLGCSGMAR
VDVFLTPENDVVINEINTLPGFTNISMYPKLWQASGLDYRSLISRLIDLALERHQANSAL
KTSMNG
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atggctaagttgcgggtgggagtcgtgttcggcggtaaatcatctgagcatgaggtatcg
ctacagtcggcgaagaacatcgtcgaggcgatggataaaacgcgttttgacgtcgtgctg
ttgggaattgataagcagggacagtggcatatcaacgatgccagcaactatctgctcaac
gaccacgatccggcgcacattgcgctgcgcccctccgacgtgacgctggcgcaaatcccg
ggtaaggaaagccagcagcttatcaacgccgacagcggccagccgctgcccgctatcgac
gttattttcccgattgtgcacggcaccctgggggaagacggatcgctgcagggcatgctg
cggatggcgaatctgccgttcgtcggctccgacgtgctgggctccgccgcctgtatggat
aaagacgtcaccaagcgcctgctgcgcgatgcgggcctcagcatcgccccctttattacc
ctgacgcgggccaaccgccagcgcgtgacctttgccgaggtgagcgaaaagctcggcctg
ccgctgtttgttaaaccggcaaaccaggggtcttcggtgggcgtcagcaaggtgaaaaac
gaagcgcagtaccagcaggcggtcgcgctggcgtttgagttcgaccacaaggtggtcgta
gagcagggaattatcgggcgcgagatcgaatgcgccgtgctcggtaatgacgaaccgcag
gccagcacctgcggcgaaatcgtgcttaacagcgaattttacgcctacgataccaagtac
atcgacgataacggcgcgcaggtggtggtgcctgccgacatcagccaggcgatcaacgat
aagatccgggcgatcgccattcaggcgtaccagacgctgggatgcagcggcatggcgcgc
gttgacgttttcctgacgccggaaaatgacgtggttatcaatgaaatcaacacgctgcct
ggttttaccaacatcagcatgtatccaaaactgtggcaggcaagcgggctggactaccgc
agcctcatttcgcggctgatcgatctggcgctggagcgccatcaggccaacagcgcgctt
aaaacgtccatgaacgggtaa

DBGET integrated database retrieval system