KEGG   Enterobacter lignolyticus G5: AO703_06370Help
Entry
AO703_06370       CDS       T04198                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
kle  Enterobacter lignolyticus G5
Brite
KEGG Orthology (KO) [BR:kle00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AO703_06370
Enzymes [BR:kle01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     AO703_06370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 FAD_oxidored HI0933_like NAD_binding_8 FAD_binding_3 Thi4 K_oxygenase FMO-like AlaDh_PNT_C Glutaredoxin DAO
Motif
Other DBs
NCBI-ProteinID: ALR75938
LinkDB All DBs
Position
1377053..1378618
Genome map
AA seq 521 aa AA seqDB search
MLDTNMKTQLRAYLEKLTRPVELIATLDDSAKSAEIRELLAEIAELSAKVTFKEDNALAV
RKPSFLITNPGSDQGPRFAGSPLGHEFTSLVLALLWTGGHPSKEAQALLEQIRDLDGDFE
FETYYSLSCHNCPDVVQALNLMAVLNPRIKHTAIDGGTFQNEITDRNVMGVPAVFMNGKE
FGQGRMTLTEIVAKVDTGAEKRAAEALNQRDAYDVLIVGSGPAGAAAAIYSARKGIRTGL
MGERFGGQVLDTVDIENYISVPKTEGQKLAGALKQHVSDYDVDVIDAQSARKLTPAAVEG
GLHQLETVSGAVLKARSIIIATGAKWRNMNVPGEDQYRTKGVTYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGIVEHVTLLEFAPEMKADQVLQNKVRSLKNVDIILNAQTTEVKGD
GSKVTGLDYRDRVSGDAHHVALSGIFVQIGLLPNTNWLEGAIERNRMGEIIVDAKCETSV
KGVFAAGDCTTVPYKQIIIATGEGAKASLSAFDYLIRTKTA
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacacgaatatgaaaacccagctcagggcttaccttgagaaactgacccggcct
gttgagctgattgccacgctggacgacagcgctaaatcggcagagatcagggagctgctg
gctgaaatcgccgaactgtcagcaaaagtcacctttaaagaagataacgctctggcggta
cgtaaaccctctttcctgattaccaatccggggtctgaccaggggccgcgcttcgccggt
tctccgctggggcatgagtttacctcgctggtgctggcgctgctgtggaccggcggtcat
ccgtcgaaagaagcgcaggcgctgctggagcagattcgcgatcttgacggtgatttcgag
tttgaaacctattattcgctctcctgtcacaactgtccggacgtggtgcaggcgctgaac
ctgatggcggtgctcaacccacgcattaagcatacggcgattgacggcggtacgttccag
aacgagattaccgatcgcaacgtaatgggcgttccggcggtctttatgaacggcaaggag
ttcggccagggccgtatgaccctgacggaaatcgtcgccaaagtggataccggcgcggag
aaacgtgcagcagaggcgctgaaccagcgcgacgcctacgatgtgctgatcgtcggctcc
ggcccggcgggtgcggcggcggcgatttactccgcccgtaaaggcattcgtaccgggctg
atgggcgagcgctttggcggtcaggtactggatactgtggacatcgagaactatatctcg
gtaccgaaaacggaaggccagaagctggcgggcgcgctcaagcagcacgtgtccgactat
gacgtcgacgtcattgacgcccagagcgcgcgcaagctgacgcctgccgccgttgaaggc
ggtttgcaccagcttgagacggtatccggcgcggtgcttaaggcgcgcagcattatcatt
gccaccggggcaaaatggcgcaacatgaacgtgccgggcgaagatcagtaccgtacgaaa
ggcgtgacctactgcccgcactgcgacggcccgctgtttaaaggcaagcgagtggcggtc
atcggcggcggtaactccggcgttgaggcggcgatcgatctggccggtattgtcgagcac
gtgaccctgctggagtttgccccggagatgaaggccgaccaggtgctgcagaataaagtc
cgcagcctgaaaaacgtcgatatcatcctcaatgcgcagactaccgaagtgaagggcgac
ggcagcaaagtgaccggtcttgactaccgtgaccgcgtcagcggcgacgcgcatcatgtc
gcgctgtcgggcatttttgttcagattggcctgttgccgaacacgaactggctggaaggc
gccattgagcgcaaccgcatgggcgaaatcatcgtcgatgcaaaatgcgaaaccagcgtg
aagggcgtgttcgcggcgggcgactgcaccaccgttccgtacaagcagataatcatcgcc
accggcgaaggcgcaaaagcctccctcagcgcgtttgattatttgattcgtaccaaaacg
gcataa

DBGET integrated database retrieval system