KEGG   Enterobacter lignolyticus G5: AO703_06955Help
Entry
AO703_06955       CDS       T04198                                 

Gene name
gpmA
Definition
(GenBank) phosphoglyceromutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
kle  Enterobacter lignolyticus G5
Pathway
kle00010  Glycolysis / Gluconeogenesis
kle00260  Glycine, serine and threonine metabolism
kle00680  Methane metabolism
kle01100  Metabolic pathways
kle01110  Biosynthesis of secondary metabolites
kle01120  Microbial metabolism in diverse environments
kle01130  Biosynthesis of antibiotics
kle01200  Carbon metabolism
kle01230  Biosynthesis of amino acids
Module
kle_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
kle_M00002  Glycolysis, core module involving three-carbon compounds
kle_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:kle00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AO703_06955 (gpmA)
  09102 Energy metabolism
   00680 Methane metabolism
    AO703_06955 (gpmA)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AO703_06955 (gpmA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:kle04131]
    AO703_06955 (gpmA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:kle04147]
    AO703_06955 (gpmA)
Enzymes [BR:kle01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     AO703_06955 (gpmA)
Membrane trafficking [BR:kle04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    AO703_06955 (gpmA)
Exosome [BR:kle04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   AO703_06955 (gpmA)
  Exosomal proteins of melanoma cells
   AO703_06955 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ALR76042
LinkDB All DBs
Position
complement(1495814..1496566)
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLVRHGESQWNNENRFTGWYDVDLSEKGVSEAKAAGKLLKDEGFSFDFAYTSVL
KRAIHTLWNVLDELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFA
VTPPELTKDDERYPGHDPRYAKLTDAELPTTESLALTIDRVVPYWNETILPRLKSGERVI
IAAHGNSLRALVKYLDNMGEDEILELNIPTGVPLVYEFDENFKPLKRYYLGNADEIAAKA
AAVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaactaagctggttctggtgcgccacggcgaaagccagtggaacaacgaaaac
cgtttcaccggttggtacgacgttgatctgtcagagaaaggcgttagcgaagcgaaagcg
gcgggcaaactgctgaaagacgaaggcttcagcttcgattttgcttatacctctgtgctg
aaacgtgccatccacacgctgtggaacgtactggatgaactggaccaggcctggctgccg
gtggagaaatcctggaaactgaacgagcgccactacggcgcgctgcagggtctgaacaaa
gcggaaaccgcagaaaaatatggcgatgagcaggtgaaacagtggcgtcgcggcttcgcg
gtaaccccgccggagctgacgaaagacgacgaacgctacccgggacacgacccgcgctat
gcgaaactgaccgacgcagagctgccaaccaccgaaagcctggcgctgaccatcgatcgc
gttgtgccgtactggaacgaaaccattctgccgcgcctgaaaagcggcgagcgcgtgatc
atcgccgcgcacggcaactccctgcgcgcgctggtgaaatacctggacaacatgggtgaa
gacgagatcctcgaactgaatattccgaccggcgtgccgctggtttatgagttcgacgag
aacttcaaaccgcttaaacgctattacctgggcaacgccgacgaaatcgccgcaaaagct
gccgccgtcgcgaaccagggtaaagcgaagtaa

DBGET integrated database retrieval system