Enterobacter lignolyticus G5: AO703_08695 Help Entry AO703_08695       CDS       T04198                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism kle  Enterobacter lignolyticus G5 Pathway kle01100   Metabolic pathways kle01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:kle00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AO703_08695   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AO703_08695 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF1896 TerB DUF1493 HLH Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  ALR76369 UniProt:  A0A806XC34 LinkDB All DBs Position 1898472..1898708 Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYINGHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgaagaacgcgttaagaaaattatcggcgagcagctgggcgttaagcag gaagaagttaccaacaatgcttccttcgttgaggacctgggcgctgattctcttgacacc gttgagctggtaatggctctggaagaagagtttgatactgagattccggacgaagaagct gagaaaatcaccaccgttcaggctgccattgattacatcaacggtcaccaggcgtaa

DBGET integrated database retrieval system