KEGG   Enterobacter lignolyticus G5: AO703_13105Help
Entry
AO703_13105       CDS       T04198                                 

Definition
(GenBank) cobalt-precorrin-6Y C(15)-methyltransferase
  KO
K02191  cobalt-precorrin-6B (C15)-methyltransferase [EC:2.1.1.196]
Organism
kle  Enterobacter lignolyticus G5
Pathway
kle00860  Porphyrin and chlorophyll metabolism
kle01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kle00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    AO703_13105
Enzymes [BR:kle01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.196  cobalt-precorrin-6B (C15)-methyltransferase [decarboxylating]
     AO703_13105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_31 MTS Cons_hypoth95 PrmA Methyltransf_25 GidB Methyltransf_12 PCMT Methyltransf_4 Methyltransf_11 Met_10 CMAS Methyltransf_18 Methyltransf_2 Methyltransf_23 DOT1 Methyltransf_15 UPF0020 PRMT5 RrnaAD
Motif
Other DBs
NCBI-ProteinID: ALR77197
LinkDB All DBs
Position
complement(2830191..2830760)
Genome map
AA seq 189 aa AA seqDB search
MKDELFLRGETVPMTKEAVRALALAKLELHRASHLIDVGAGTGSVSIEAALQFPSLHVTA
IERNPSALRLLDENRQHFACSNIDILPGVAPIAVAEKADAVFMGGSGGHLTPLIDWSMRQ
LHPGGRLVMTFILMENLNSALAHLQQTGAQNVDCLQMQVSTLATLGSGHYFKPNNPVFVI
ACQKEEHHV
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatgagcttttcctgcgcggtgagacggtgccgatgaccaaagaggcggtacgc
gcgctggccctcgcgaaactggagctgcatcgcgccagccacctgattgacgtcggggca
gggaccgggagcgtgtcgattgaagccgcgctgcagtttccttctctgcacgtgacggct
attgaacgcaacccgtcggccctgcggctgcttgatgaaaaccgtcagcattttgcctgt
agcaatatcgatattctgcccggcgtggcgccgatagcggtagctgaaaaagccgatgcg
gtgtttatgggcggcagcggcggccatctgacgccgcttattgactggtccatgcgtcag
cttcatcccggcggtcgtctggtgatgacctttatcctgatggaaaacctcaatagcgcg
ctggctcacctccagcagaccggcgcgcagaatgtggattgtctgcaaatgcaggtatca
acgctcgctacgcttggcagcggccactatttcaaaccgaataatcccgtttttgttatc
gcctgtcagaaggaagaacaccatgtctga

DBGET integrated database retrieval system