KEGG   Enterobacter lignolyticus G5: AO703_14475Help
Entry
AO703_14475       CDS       T04198                                 

Definition
(GenBank) FAD/NAD(P)-binding oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
kle  Enterobacter lignolyticus G5
Pathway
kle00564  Glycerophospholipid metabolism
kle01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:kle00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    AO703_14475
Enzymes [BR:kle01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     AO703_14475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO Fer2_BFD FAD_binding_2 FAD_oxidored FAD_binding_3 DAO_C Thi4 Pyr_redox_2 3HCDH_N HI0933_like NAD_binding_8 SO_alpha_A3 Pyr_redox_3 Lycopene_cycl GIDA
Motif
Other DBs
NCBI-ProteinID: ALR77451
LinkDB All DBs
Position
3143836..3145464
Genome map
AA seq 542 aa AA seqDB search
MTFSQKHESDVIIIGGGATGAGIARDCALRGLSVILVERDDIATGATGRNHGLLHSGARY
AVTDGESARECIAENQILKRIARHCIEPTDGLFITLPEDSMAWQSQFIDACQNAGISAEP
LTAQEALRLEPSVNPSLLGAVRVPDGTVDPFRLTAANMLDAREHGATILTGCEVTGLIRQ
NDRVVGVTVFDRTHGEQKDLYAQMVVNAGGIWGQRIAEYADLRIRMFPAKGSLLIFDHRI
NRHVINRCRKPADADILVPGDTISLIGTTSTHIDYRDIDDNRVTAAEVDTLLREGEKLSP
IMAQTRILRAYCGVRPLVASDDDPSGRNVSRGIVLLDHAERDGLEGFITITGGKLMTYRL
MAEWATDAVCRKLDHAATCSTADTPLPGSREPTEKTLHKVISLPAPLRGSAVYRHGDRTP
AWLGDTRLHRSLVCECEAVTAGEVQYAVENLAVKNLLDLRRRTRVGMGTCQGELCACRAA
ALLNRYQVTTPAQSLNQLSEFLNERWKGVQPIAWGDALRESEFTRWVWQGLCGLEKEYPH
EL
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgaccttcagccagaaacatgaaagcgatgtgattattatcggcggcggtgcgaccggc
gcgggcattgcccgcgattgcgcgctgcgtgggctcagcgtcattcttgttgaacgtgat
gacattgccaccggcgcgaccggacgtaaccacggcctgctgcacagcggcgcgcgctat
gccgtgaccgacggcgaatccgcccgggaatgtatcgcggaaaaccagatcctcaagcgc
atcgcccgccactgtatcgaacccaccgacggcctgtttatcaccctgccggaagacagc
atggcctggcaaagccagttcattgacgcctgccagaacgccggtatcagcgcggaaccg
ctgacggcgcaggaggcgctgcgccttgaaccgtccgttaacccgtcgctgctgggcgcg
gtcagggtgccggacggcaccgttgatcccttccgcctgacggccgccaacatgctggac
gcccgcgaacatggcgccaccatcctcaccggctgcgaagtcaccggccttatccgccag
aatgaccgcgtcgtcggcgtgacggttttcgacagaacccacggcgagcaaaaagatctc
tacgcacagatggtggtcaacgcgggcggaatctggggccagcgcatcgcggaatatgcc
gatctgcgtattcgtatgttcccggcgaaagggtcgctgctgattttcgatcaccgcatc
aaccggcacgtcatcaaccgctgccgcaaaccggcggatgccgatattctggtgcccggc
gacactatttcacttattggcactacctccacccatattgactatcgcgatatcgatgat
aaccgggtgacggcggcggaggtcgacacgctgctgcgcgaaggcgagaagctgtcgccc
atcatggcgcagacgcggattttacgcgcctactgcggcgttcgccctctggtcgccagc
gacgacgaccccagcggccgcaacgtcagccgcggaattgtgctgcttgaccacgcggag
cgcgacgggctggaaggctttatcaccattaccggcggaaagctgatgacctaccgcctg
atggccgagtgggctaccgatgcggtctgccgcaagcttgaccatgccgcgacctgttcg
acggccgacacgccgctgccggggtcccgggagccgacggaaaaaacgctgcataaggtt
atctcattaccggcgccgctgcggggctccgccgtgtatcgccacggcgacagaacgccc
gcctggctcggcgatacccgcctgcaccgcagtctggtgtgcgaatgtgaagccgtaacg
gcgggggaagtacagtacgcggttgagaatctggcggtgaagaacctgctagacctgcgg
cgcagaacccgcgtcggcatgggcacctgccagggcgaactgtgcgcctgccgcgccgcg
gccctgctcaaccgctaccaggtcaccacgccggcgcagtcgttgaatcaactctcggaa
tttcttaacgaacgctggaaaggcgtccagccgatcgcgtggggagatgcgctgcgtgaa
agcgaatttacccgctgggtatggcaggggttatgcggattagaaaaggagtatccacat
gaactttga

DBGET integrated database retrieval system