KEGG   Enterobacter lignolyticus G5: AO703_19850Help
Entry
AO703_19850       CDS       T04198                                 

Gene name
glpD
Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
kle  Enterobacter lignolyticus G5
Pathway
kle00564  Glycerophospholipid metabolism
kle01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:kle00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    AO703_19850 (glpD)
Enzymes [BR:kle01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     AO703_19850 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored Pyr_redox_2 NAD_binding_8 3HCDH_N FAD_binding_2 Lycopene_cycl GIDA
Motif
Other DBs
NCBI-ProteinID: ALR78446
LinkDB All DBs
Position
4262918..4264426
Genome map
AA seq 502 aa AA seqDB search
METKDLIVIGGGINGAGIAADAAGRGLSVLMLEAQDLACATSSASSKLIHGGLRYLEHYE
FRLVSEALAEREVLLKMAPHIAFPMRFRLPHRPHLRPAWMIRIGLFMYDHLGKRTSLPGS
AGLRFGAESVLKPEIVRGFEYSDCWVDDARLVLANAQMVVKKGGEVLTRTRATAARRENG
LWIVDAEDIDTGKKYSWQAKGLVNATGPWVKQFFDDGMHLPSPYGIRLIKGSHIVVPRVH
TQKQAYILQNEDKRIVFVIPWMDEFSIIGTTDVEYKGDPKNVEIDESEISYLLKVYNAHF
NKQLGRDDIVWTYSGVRPLCDDESDSPQAITRDYTLDIHDDHGKAPLLSVFGGKLTTYRK
LAEHALEKLTPYYQGIGPAWTKGAVLPGGEIGGDRDDFAARLRRRYPFISESLARHFART
YGSNSEQILGEAKEIADLGEHFGHEFYEAELRYLVEHEWVRRLDDAIWRRTKQGMWLNAE
EQSRVAQWLLQHAGKRELSLAS
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atggaaaccaaagatctgattgtgataggcggtggcatcaacggtgccggcatcgcggca
gacgccgctggacgcggtttatccgtgctgatgctcgaagcgcaggaccttgcctgcgcc
acctcaagcgccagttcgaagcttattcatggcggcctgcgctaccttgaacactacgaa
ttccgcctggtgagcgaggcgctggccgaacgtgaagtgctgctgaagatggcgccgcac
atcgccttcccgatgcgttttcgtctgccccaccgtccgcatctgcgtccggcgtggatg
atccgcattggtctttttatgtacgaccacctcggaaaacgcaccagcctgccgggctct
gccggattgcgatttggcgcagaatcggtcctcaagccggaaatcgtgcgcggtttcgaa
tattccgactgctgggtggatgatgcgcgtctggtgctggctaatgcgcagatggtggtg
aaaaaaggcggcgaagtgctgacccgcacccgcgcaaccgccgcccgtcgcgaaaacggc
ctgtggattgtcgacgcggaagatatcgataccggcaagaaatacagctggcaggcgaaa
ggcctggtcaacgccaccggcccgtgggtgaaacaattctttgacgacggcatgcacctg
ccatcgccgtacggcatccgcctgattaagggcagccatatcgtagtgccgcgcgttcac
acccagaagcaggcctatatcctgcaaaacgaagataaacgcatcgtgttcgtgatcccg
tggatggacgaattctccatcatcggcactacggacgtggaatataaaggcgacccgaaa
aacgttgagatcgacgagagcgaaatcagctacctgctgaaggtctataacgcgcatttc
aacaagcagcttggccgtgacgatatcgtctggacctactccggcgtccgtccgctgtgc
gatgatgaatccgactcgccgcaggccatcacccgcgactatacgctggatatccacgac
gaccacggcaaagcgccactgctgtcggtctttggcggtaagctcaccacctaccgtaag
ctggcggaacacgcgctggaaaaactgacgccgtactatcagggcatcggcccggcgtgg
accaaaggcgcggtgctgcccggcggagagatcggcggcgaccgtgacgattttgccgcc
agactgcgccgtcgctatccgttcatcagcgaatcattagcccgccacttcgcccgcacc
tacggcagcaacagcgagcaaatccttggcgaagcgaaagagattgcggatctcggcgaa
catttcggccacgagttctatgaagccgagctgcgctatctggtggagcatgagtgggtg
cgccgtctggacgatgccatctggcgtcgcacaaaacaggggatgtggctgaatgcggag
gagcagtcgcgcgtcgcgcagtggctgttacagcatgcgggaaagcgtgaactgtcgtta
gcgtcgtag

DBGET integrated database retrieval system