KEGG   Klebsiella sp. LTGPAF-6F: BJF97_01155Help
Entry
BJF97_01155       CDS       T05751                                 

Definition
(GenBank) multifunctional fatty acid oxidation complex subunit alpha
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
kll  Klebsiella sp. LTGPAF-6F
Pathway
kll00071  Fatty acid degradation
kll00280  Valine, leucine and isoleucine degradation
kll00281  Geraniol degradation
kll00310  Lysine degradation
kll00362  Benzoate degradation
kll00380  Tryptophan metabolism
kll00410  beta-Alanine metabolism
kll00640  Propanoate metabolism
kll00650  Butanoate metabolism
kll00903  Limonene and pinene degradation
kll00930  Caprolactam degradation
kll01100  Metabolic pathways
kll01110  Biosynthesis of secondary metabolites
kll01120  Microbial metabolism in diverse environments
kll01130  Biosynthesis of antibiotics
kll01200  Carbon metabolism
kll01212  Fatty acid metabolism
Module
kll_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:kll00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    BJF97_01155
   00650 Butanoate metabolism
    BJF97_01155
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BJF97_01155
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BJF97_01155
   00310 Lysine degradation
    BJF97_01155
   00380 Tryptophan metabolism
    BJF97_01155
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BJF97_01155
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BJF97_01155
   00281 Geraniol degradation
    BJF97_01155
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BJF97_01155
   00930 Caprolactam degradation
    BJF97_01155
Enzymes [BR:kll01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     BJF97_01155
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BJF97_01155
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     BJF97_01155
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     BJF97_01155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: AOV09725
UniProt: A0A1D8JLY0
LinkDB All DBs
Position
complement(245853..248042)
Genome map
AA seq 729 aa AA seqDB search
MLYKGDTLYLDWREDGIAELVFDAPGSVNKLDTATVASLGEALDVLEKQKDLQGLLLRSE
KAAFIVGADITEFLSLFLVPEEQLSQWLHFANSVFNRLEDLPVPTISAVNGYALGGGCEC
VLATDYRLATPDLRIGLPETKLGIMPGFGGSVRMPRMLGADSALEIIAAGKDVGAEQALK
IGLVDGVVKHEKLIDGAVAILRQAIKGDLDWKAKRQPKLEPLHLSKIEAAMSFTIAKGMV
AQTAGKHYPAPITAVKTIEAAARFGREEALDLENKSFVPLAHTNEARALVGIFLNDQYVK
AKAKKLTKDIDTPKHAAVLGAGIMGGGIAYQSAWKGVPVVMKDINDKSLTLGMTEAAKLL
NKQLERGKIDGLKMAGVISTIQPTLDYAGFERVDVVVEAVVENPKVKKAVLAETEDKVRP
DTVLASNTSTIPISELASVLKRPENFCGMHFFNPVHRMPLVEIVRGEKSSDETIAKVVAW
ASKMGKTPIVVNDCPGFFVNRVLFPYFAGFSQLLRDGADFRKVDKVMEKQFGWPMGPAYL
LDVVGIDTAHHAQAVMAAGFPQRMQKDYRDAIDALFDANRFGQKNGLGFWRYKEDSKGKP
KKEEDAAVDSLLAEVSQPKRDFSDEEIIARMMIPMVNEVVRCLEEGIIASPAEADMALVY
GLGFPPFHGGAFRWLDTLGSAKYLDMAQQYQHLGPLYDVPEGLRSKARHNEPYYPPVEPA
RAPGDLKKA
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgctctacaaaggcgacaccctgtacctcgactggcgggaagacggcattgccgaactg
gtatttgatgcccccggctcggtcaacaagctcgataccgcaaccgtagccagcctcggt
gaagcgctggacgtactcgaaaaacaaaaagatctgcaagggctgctgctacgctccgag
aaagccgcttttattgtcggcgcggatatcaccgaatttctttctctgttcctggttccc
gaagaacagctcagccagtggctgcatttcgctaatagcgtatttaatcgcctggaagat
ttgccggttccgaccatctccgccgtcaacggctatgcgttgggcggcggctgcgaatgc
gtgctggcgaccgattatcgcctggcgacgccggatctgcgcattggtctgccggaaacg
aagctgggcatcatgccgggctttggcggctcggtgcggatgccgcggatgcttggcgcg
gacagcgcgctggaaatcattgccgccggcaaagacgttggcgccgaacaggccttaaaa
atcggcctcgtcgatggcgtggttaagcatgaaaaactgatcgatggcgcggtcgcgatt
ctgcgtcaggctattaaaggcgacctggactggaaggcgaagcgccagccgaagctggag
ccgctgcatctgagtaaaattgaagccgcgatgagttttaccatcgccaaaggcatggtg
gcgcaaaccgccgggaagcactacccggccccgattaccgccgttaaaaccatcgaagcc
gccgcccgctttggccgcgaagaagcgctggatctggaaaataaaagtttcgtcccgctg
gcgcataccaacgaggcgcgtgcgctggtaggtatcttccttaacgatcagtacgtcaaa
gcaaaagcgaagaagctgacgaaagatatcgacacgccaaaacacgcggccgtgctgggc
gcggggattatgggcggcggcattgcataccagtcagcctggaaaggcgtgccggtggtc
atgaaagatatcaacgacaaatcgctgacgctgggcatgaccgaagcggccaagctgctg
aataaacagcttgagcgcggcaaaatcgacggtcttaagatggctggcgtcatttctact
attcagccaaccctggattacgccggctttgaacgcgtggacgtcgtggtcgaagccgtt
gttgagaatccgaaagtgaaaaaagcggtgctggcggaaacggaagacaaagtccgcccg
gataccgtgctggcttcgaatacctccaccattcccatcagcgagttggccagcgtactg
aagcgcccggaaaacttctgtggtatgcacttctttaacccggtgcaccggatgccgctg
gtcgagatcgttcgcggcgaaaaaagctcggacgaaaccattgcgaaagtggtcgcctgg
gccagcaaaatgggcaaaacgccgattgtggtcaacgactgccccggtttctttgttaac
cgcgtgctgttcccctacttcgccggtttcagccagctgctgcgcgacggcgcggacttc
cgcaaagtcgataaagtgatggagaagcagtttggctggccgatgggcccggcctatctg
ctggacgtcgttggcattgataccgcgcatcacgcgcaggcggtcatggcggcgggcttc
ccgcagcggatgcagaaagattatcgcgatgcgatcgatgcgctgttcgacgctaaccgt
ttcggccagaaaaatggcctcggcttctggcgctacaaagaagacagtaaaggtaaaccg
aagaaggaagaggatgccgcagtcgatagcctgctggcggaagttagccagccgaagcgt
gatttcagcgatgaagagattatcgcccgcatgatgatccccatggttaatgaagtggtg
cgctgtctcgaagagggcattatcgccagcccggcagaagccgatatggcgctggtttat
ggcctgggcttccctccgttccacggcggcgcgttccgctggctggatacgctcggtagc
gcaaaatatctcgatatggcccagcagtatcagcatctcggcccgctatacgacgtgccg
gaaggattgcgcagcaaagcgcgtcataacgaaccgtactatccaccagttgagcctgcc
cgtgcgccaggcgacctgaaaaaggcttaa

DBGET integrated database retrieval system