KEGG   Klebsiella sp. LTGPAF-6F: BJF97_06655Help
Entry
BJF97_06655       CDS       T05751                                 

Definition
(GenBank) D-alanine--D-alanine ligase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
kll  Klebsiella sp. LTGPAF-6F
Pathway
kll00473  D-Alanine metabolism
kll00550  Peptidoglycan biosynthesis
kll01100  Metabolic pathways
kll01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:kll00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BJF97_06655
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BJF97_06655
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    BJF97_06655
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:kll01011]
    BJF97_06655
Enzymes [BR:kll01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     BJF97_06655
Peptidoglycan biosynthesis and degradation proteins [BR:kll01011]
 Precursor biosynthesis
  Amino acid ligase
   BJF97_06655
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 ATP-grasp_3 ATPgrasp_ST RimK GARS_A NHase_alpha
Motif
Other DBs
NCBI-ProteinID: AOV14913
UniProt: A0A1D8K1R4
LinkDB All DBs
Position
complement(1423782..1424879)
Genome map
AA seq 365 aa AA seqDB search
MAKMRVGIVFGGKSAEHEVSLQSAKNIVEAIDKTRFDVVLLGIDKQGQWHINDASNYLLN
PQDPAHIALRPSDITLAQIPGREAQQLINADSGQPLAAIDVIFPIVHGTLGEDGSLQGML
RMANLPFVGSDVLGSAACMDKDVTKRLLRDAGLSIAPFITLTRANRHQVSFAEVQAKLGL
PLFVKPANQGSSVGVSKVNSEEQYQQAVALAFEFDHKVVVEQGIKGREIECAVLGNDNPE
ASTCGEIVLNSEFYAYDTKYIDDQGAKVVVPAAIDSDVNDKIRDIAVRAYQTLGCSGMAR
VDVFLTADNDVVINEINTLPGFTNISMYPKLWQASGLDYTSLISRLIELALERHAADRAL
KTSMN
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atggctaagatgagggttgggatcgttttcggcggtaagtcggcagaacatgaagtatcg
ctacagtcagcgaaaaatatcgtggaagccatcgacaaaacgcgcttcgacgtcgttttg
ctggggattgataagcaggggcagtggcatatcaacgacgccagcaactatctgctcaat
ccgcaggaccccgcccatattgccctgcgcccatccgatattaccctggcgcaaattccc
ggacgcgaagcgcagcagctgattaacgccgatagcggccagccgctggcggccatcgac
gtcattttcccgattgttcacggcacccttggggaagatggttctctgcagggtatgctg
cggatggctaacctgcccttcgtcggctccgacgtcctcggctccgcagcctgcatggac
aaagacgtgaccaagcgtctgctgcgcgatgccgggctgtcgattgcgccttttattacc
ctgacccgcgccaaccgtcatcaggtgagctttgccgaagtgcaggcgaagctgggcctg
ccgctgttcgtcaaaccggcgaaccagggctcctcggtgggcgtcagcaaggtcaacagc
gaagagcagtatcagcaggccgtcgccctggccttcgaatttgaccataaagtggtggtt
gaacaggggattaaagggcgtgagatcgagtgcgcggtattgggcaacgataatcccgag
gccagcacctgcggtgaaatcgtcctcaacagcgaattctacgcctatgacaccaagtac
attgacgatcagggcgcgaaggtggtggttccggcggccatcgacagcgatgtaaacgat
aaaattcgcgatatcgccgttcgcgcctaccagaccctcggctgcagcgggatggcgcgg
gtcgatgtgttcctgaccgccgataacgacgtggtgattaacgaaatcaatacgctgccg
ggcttcaccaacatcagcatgtatccgaagctatggcaggccagcggtctggactatacc
agcctgattagccgcctgattgagctggcgcttgagcgtcacgccgccgatcgggcgctg
aaaacatcgatgaattaa

DBGET integrated database retrieval system